DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13280 and gfod2

Sequence 1:NP_609812.1 Gene:CG13280 FlyBaseID:FBgn0032609 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001025591.1 Gene:gfod2 XenbaseID:XB-GENE-5740207 Length:384 Species:Xenopus tropicalis

Alignment Length:420 Identity:89/421 (21%)
Similarity:138/421 (33%) Gaps:136/421 (32%)


  Fly    82 GVWVVDEGPTLRWGIAPVSLM-ADDFAAALSVLPEQHHRIVSCVAAYQSHALAFAERHQVENVYT 145
            |:.|...|.|.|   ..:||: ||.|:            |.:........|...||...:.....
 Frog     6 GIGVFGTGNTAR---VLISLLRADGFS------------IEALWGKTDEEAKELAEEMGIPFYTC 55

  Fly   146 SFEDLAKCPNVDVVYISPLNPQHSELCHLMLNHDKHVLCEKPL----CMTEEQVTKLLEKARARG 206
            ..:|:.....||:|.||...|...::....|...|:|:|||..    ..|..:..:...|     
 Frog    56 HTDDVLLHQEVDLVCISIPPPLTRQIAVKALGIGKNVICEKAASSIDAFTMVKAARYYPK----- 115

  Fly   207 LFLMEGMWPRCVPAYHYLRHQIL-RNRLGEIK--QVHCTLGLPVSQG-------RLGLYGGVTND 261
            |..:.|...|.:||:..:|..|| :|.:|||:  .|....|..:|..       .:|  ||..:.
 Frog   116 LMSLVGNALRFLPAFDRMRQLILEQNYVGEIRICDVRVYGGSLLSSNYSWICDDLMG--GGGLHT 178

  Fly   262 FGVYGMQLALWVFREVPRCLKVSGRV-----NSEHVD----VSADIELCFTRGKRALIEVSSEKK 317
            .|.|.:.|...:..:  |..||.|.:     .:|.:.    |::| :.||.:             
 Frog   179 LGTYLVDLLTHLTNK--RAEKVHGFLKTFVKQNEAISGIRYVTSD-DFCFFQ------------- 227

  Fly   318 LSNQAVIQGKDGSIKMNNYWCPTRLITEEVDYEFPLPGGDQLPPTHYH--------NRLGMCYEA 374
                         ::|....|.|      |...|.:||      |..|        .||      
 Frog   228 -------------MQMTGGACST------VTLNFNMPG------TFVHEVMVVGSAGRL------ 261

  Fly   375 EEVRNCILKGSTESDDFSHNESLLLANLMDTIHAELGVGEFANRNEVSDLQKQIENVQDIVKDPE 439
             .||...|.|...|   :..|.|||::                     .|.::|.::.|..|.|.
 Frog   262 -VVRGTELFGQKNS---ASEEKLLLSD---------------------PLTREIADISDFEKVPP 301

  Fly   440 ELASETCRVVEDISMGGRSLDINRQEVKDQ 469
            ........:|:.:          ||..:||
 Frog   302 PYLMGIAHMVKAL----------RQSFQDQ 321

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13280NP_609812.1 MviM 89..387 CDD:223745 72/330 (22%)
GFO_IDH_MocA 92..213 CDD:279716 27/126 (21%)
gfod2NP_001025591.1 MviM 1..365 CDD:223745 89/421 (21%)
GFO_IDH_MocA 7..118 CDD:279716 29/131 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0673
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.