DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13280 and gfod1

DIOPT Version :9

Sequence 1:NP_609812.1 Gene:CG13280 / 35015 FlyBaseID:FBgn0032609 Length:473 Species:Drosophila melanogaster
Sequence 2:XP_009295943.1 Gene:gfod1 / 556899 ZFINID:ZDB-GENE-091118-89 Length:391 Species:Danio rerio


Alignment Length:365 Identity:77/365 - (21%)
Similarity:134/365 - (36%) Gaps:93/365 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 YTS-FEDLAKCPNVDVVYISPLNPQHSELCHLMLNHDKHVLCEK---PL----CMTEEQ-VTKLL 199
            ||: .:|:...|:||:|.|:...|...::....|...|:|:|::   ||    .|:..| ..|||
Zfish    51 YTNRIDDVLLHPDVDLVCINLPPPLTRQIAVKTLGIGKNVICDRTATPLDAFRMMSAAQYYPKLL 115

  Fly   200 EKARARGLFLMEGMWPRCVPAYHYLRHQILRNRLGEI----KQVHCTLGLPVSQGRLG------- 253
            .         :.|...|.:||:..::..:....:||:    .|||       |...||       
Zfish   116 S---------IMGNVLRFLPAFVRMKELLEEGYIGELMVCEAQVH-------SGSLLGKKYNWSC 164

  Fly   254 ---LYGGVTNDFGVYGMQLALWVFREVPRCLKVSGRV-----NSEHV----DVSAD----IELCF 302
               :.||..:..|.|.:.|.  .|....|..||.|.:     .::|:    .:::|    .::..
Zfish   165 DDLMGGGGLHSVGSYIIDLL--TFLTGRRAAKVHGFLKTFVKQTDHIRGIRQITSDDFCTFQMVL 227

  Fly   303 TRGKRALIEVSSE--KKLSNQAVIQGKDGSIKMNNYWCPTRLITEEVDYEF---------PLPGG 356
            ..|....:.::..  .:...:.|:.|..|.:|:    |.|.|..::.|.|.         ...|.
Zfish   228 EGGACCTVTLNFNVPGEFRQEVVVVGTAGRLKV----CGTDLYGQKNDGECGQELLLKDKTAIGN 288

  Fly   357 DQLP-------PTHYHNRLGMCYEAEEVRNCILKGSTESDD---FSHNESLLLANLMDTIHAELG 411
            ..||       |:.|  ..|.....:.||...    .:.||   :......:.|...|.::|...
Zfish   289 ASLPDKAFRDIPSPY--LTGTICMVQAVRQAF----QDQDDRRTWDGRPLTMAATFEDCLYALCV 347

  Fly   412 VGEFANRNEVSDLQKQIENVQDIVKDPE----ELASETCR 447
            |......|:..:.|    |::.:.::||    .|.||..|
Zfish   348 VDTIKKSNQCGEWQ----NIEVMTEEPEVSPAYLISEAMR 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13280NP_609812.1 MviM 89..387 CDD:223745 62/296 (21%)
GFO_IDH_MocA 92..213 CDD:279716 20/77 (26%)
gfod1XP_009295943.1 MviM 5..>260 CDD:223745 48/226 (21%)
GFO_IDH_MocA 5..117 CDD:279716 20/74 (27%)
GFO_IDH_MocA_C 132..>195 CDD:304482 15/71 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0673
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.