DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13280 and zgc:101723

Sequence 1:NP_609812.1 Gene:CG13280 FlyBaseID:FBgn0032609 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001005600.1 Gene:zgc:101723 ZFINID:ZDB-GENE-040927-25 Length:334 Species:Danio rerio

Alignment Length:329 Identity:123/330 (37%)
Similarity:186/330 (56%) Gaps:12/330 (4%)


  Fly    92 LRWGIAPVSLMADDFAAALSVLPEQHHRIVSCVAAYQSHALAFAERHQVENVYTSFEDLAKCPNV 156
            |||||.....::.||..||..|..:.|::|:..|...:||..||::|.:...|.|:|:||:.|.:
Zfish     3 LRWGICSAGKISHDFTVALRTLQAEQHQVVAVAARELAHAQEFAQKHSIPRAYGSYEELAEDPEI 67

  Fly   157 DVVYISPLNPQHSELCHLMLNHDKHVLCEKPLCMTEEQVTKLLEKARARGLFLMEGMWPRCVPAY 221
            ||||:..::|.|..:..|.:|..|:|||||||.|..::|.:::..||...:||||.:|.|..||.
Zfish    68 DVVYVGTIHPHHLRVGLLFMNAKKNVLCEKPLAMNLKEVQQMISAARRSDVFLMEAVWTRFFPAS 132

  Fly   222 HYLRHQILRNRLGEIKQVH-----CTLGLP-VSQGRLGLYGGVTNDFGVYGMQLALWVFR-EVPR 279
            ..:...:.:|.:|::|.|.     ..||:| ..|..||  ||...|.|:|.:|..|.||. |.|.
Zfish   133 LEISRLLSQNAVGQVKLVRADFGAALLGVPRAVQKHLG--GGALLDIGIYCIQFVLMVFNGEKPE 195

  Fly   280 CLKVSGRVNSEHVDVSADIELCFTRGKRALIEVSSEKKLSNQAVIQGKDGSIKM-NNYWCPTRLI 343
            .::.||......||.:..:.|.|:..:.|:...:...:|.|:|:|.|.:.:||: .:.||||.|:
Zfish   196 QIQASGVCLDTGVDEAMVVTLKFSGHRLAVCTCTVAAELPNEALIVGTEATIKVPAHMWCPTTLL 260

  Fly   344 TEEVDYEFPLPGGDQLPPTHYHNRLGMCYEAEEVRNCILKGSTESDDFSHNESLLLANLMDTIHA 408
            ...|:.:||:|  |...|.::.|..||.|||||||.|:|.|..||...||.:|.|||::||....
Zfish   261 VNGVETQFPVP--DPHLPLNFINSTGMRYEAEEVRRCVLAGLKESSRMSHADSALLADIMDEARR 323

  Fly   409 ELGV 412
            ::||
Zfish   324 QVGV 327

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13280NP_609812.1 MviM 89..387 CDD:223745 111/303 (37%)
GFO_IDH_MocA 92..213 CDD:279716 48/121 (40%)
zgc:101723NP_001005600.1 MviM 1..326 CDD:223745 121/327 (37%)
GFO_IDH_MocA 3..121 CDD:279716 46/118 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C234868124
eggNOG 1 0.900 E1_COG0673
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D351032at33208
OrthoFinder 1 1.000 FOG0001785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22604
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.