DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13280 and blvra

Sequence 1:NP_609812.1 Gene:CG13280 FlyBaseID:FBgn0032609 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001006896.1 Gene:blvra XenbaseID:XB-GENE-1007964 Length:290 Species:Xenopus tropicalis

Alignment Length:163 Identity:37/164 (23%)
Similarity:62/164 (38%) Gaps:22/164 (13%)


  Fly    95 GIAPVSLMADDFAAALSVLPEQHHRIVSCVAAYQSHALAFAERHQVENVYTSFEDLAKCPNVDVV 159
            |||. |:...|....|...|.:..:::..|:..:..  .|....|:|     .::..|..::|..
 Frog    10 GIAG-SMRIRDLLNPLQSSPSESLKLIGFVSRRKLD--QFNNAKQIE-----LDEALKSKDIDAA 66

  Fly   160 YISPLNPQHSELCHLMLNHDKHVLCEKPLCMTEEQVTKLLEKARARGLFLMEGMWPRCVPAYHYL 224
            :|...|..|.|.....|...||||.|.|:.::.|....|...|..:|..|            |..
 Frog    67 FICTDNQNHEESVRHFLEVGKHVLVEYPMALSAEAAYDLWRLAEQKGKVL------------HVE 119

  Fly   225 RHQILRNRLGEIKQVHCTLGLPVSQGRLGLYGG 257
            ..::|..:..::|:.  ..|..:.:|.|...||
 Frog   120 HIELLTEQYKQLKKE--VQGKKLVEGVLHFTGG 150

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13280NP_609812.1 MviM 89..387 CDD:223745 37/164 (23%)
GFO_IDH_MocA 92..213 CDD:279716 29/118 (25%)
blvraNP_001006896.1 GFO_IDH_MocA 2..120 CDD:279716 30/130 (23%)
Biliv-reduc_cat 128..240 CDD:312620 6/26 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0673
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.