DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13280 and dhdh

Sequence 1:NP_609812.1 Gene:CG13280 FlyBaseID:FBgn0032609 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001005045.1 Gene:dhdh ID: Length:330 Species:Xenopus tropicalis

Alignment Length:328 Identity:111/329 (34%)
Similarity:176/329 (53%) Gaps:12/329 (4%)


  Fly    93 RWGIAPVSLMADDFAAALSVLPEQHHRIVSCVAAYQSHALAFAERHQVENVYTSFEDLAKCPNVD 157
            :|||.....:::||..|||.||...|::|:..|.....|..||:.|.:...|.|:|:|||.|::|
 Frog     4 KWGICSAGKISNDFVVALSTLPAVDHQVVAIAARDLEKAKNFAQNHNIPKAYGSYEELAKDPDID 68

  Fly   158 VVYISPLNPQHSELCHLMLNHDKHVLCEKPLCMTEEQVTKLLEKARARGLFLMEGMWPRCVPAYH 222
            |:|:..::|.|.::..:.|.:.|::||||||.|...||.:|:..||...:||||..|.|..|.|.
 Frog    69 VIYVGAIHPVHRDVVLMCLQNGKNILCEKPLAMNAAQVQELIATARKFNVFLMEAFWSRFFPVYE 133

  Fly   223 YLRHQILRNRLGEIKQVHCTLGLPV------SQGRLGLYGGVTNDFGVYGMQLALWVFR-EVPRC 280
            .:|..:.:..:|::|.:....|:.:      .:..||  ||...|.|.|.:|....||. |.|..
 Frog   134 EIRALLSQKAIGDVKFIRAEFGVEIYKVPRAVEKELG--GGALLDIGCYCVQFVTMVFNGERPES 196

  Fly   281 LKVSGRVNSEHVDVSADIELCFTRGKRALIEVSSEKKLSNQAVIQGKDGSIKM-NNYWCPTRLIT 344
            :...|.::...||.|..:.|.::..::|::..:....|.|||.|.|..|.|:: ::.|.||.:|.
 Frog   197 VTAKGFLHETGVDESMSLILQYSGKRQAVLSSTIMATLPNQAAICGTKGIIQIPSDMWSPTSIIV 261

  Fly   345 EEVDYEFPLPGGDQLPPTHYHNRLGMCYEAEEVRNCILKGSTESDDFSHNESLLLANLMDTIHAE 409
            ...:.:|.:|  ....|.::.|..||.||||.||.|:|||..||...|..:|.::|::||....:
 Frog   262 NGKERKFDIP--HTTKPMNFSNGTGMSYEAEHVRQCLLKGLKESPIMSLADSEMVASIMDEALQQ 324

  Fly   410 LGV 412
            |||
 Frog   325 LGV 327

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13280NP_609812.1 MviM 89..387 CDD:223745 101/302 (33%)
GFO_IDH_MocA 92..213 CDD:279716 47/120 (39%)
dhdhNP_001005045.1 MviM 1..323 CDD:223745 108/323 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C234871644
eggNOG 1 0.900 E1_COG0673
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D351032at33208
OrthoFinder 1 1.000 FOG0001785
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.800

Return to query results.
Submit another query.