DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13280 and dhdhl

Sequence 1:NP_609812.1 Gene:CG13280 FlyBaseID:FBgn0032609 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_999900.1 Gene:dhdhl ZFINID:ZDB-GENE-040426-2180 Length:334 Species:Danio rerio

Alignment Length:328 Identity:121/329 (37%)
Similarity:166/329 (50%) Gaps:12/329 (4%)


  Fly    93 RWGIAPVSLMADDFAAALSVLPEQHHRIVSCVAAYQSHALAFAERHQVENVYTSFEDLAKCPNVD 157
            ||||.....::.||..||..|.||.|:||:..|.....|..||:.|.:...|.|:::|.|.||:|
Zfish     4 RWGICGSGNISHDFCVALRTLAEQEHQIVAVAARSLERAQKFAKTHGIPKAYGSYQELVKDPNID 68

  Fly   158 VVYISPLNPQHSELCHLMLNHDKHVLCEKPLCMTEEQVTKLLEKARARGLFLMEGMWPRCVPAYH 222
            ||||..::..|..:..|.||..|.||||||..|...::.:|:...|...:||||.||.||.|.|.
Zfish    69 VVYIGVVHTHHLPVGLLFLNAGKSVLCEKPFTMNSRELRQLISATRENNVFLMEAMWSRCFPVYS 133

  Fly   223 YLRHQILRNRLGEIKQVHCTLGLPV------SQGRLGLYGGVTNDFGVYGMQLALWVFR-EVPRC 280
            .:...:....:||:|.|....||.:      :|...|  ||.....|||.:|.||.||. |.|..
Zfish   134 EISRLLSEQAVGEVKMVSVYFGLNLLDRIHTTQKEQG--GGSLLYIGVYCVQFALMVFNGEKPES 196

  Fly   281 LKVSGRVNSEHVDVSADIELCFTRGKRALIEVSSEKKLSNQAVIQGKDGSIKMNN-YWCPTRLIT 344
            :..:|.:....||.|..:.|.|:..:.|:...|....|.|.|.|.|..|:|.::: ..|||.|..
Zfish   197 ISATGVLLPSGVDESMVVVLKFSGNRIAVCSSSLACALPNTASIFGTTGTITVSSPMHCPTTLEV 261

  Fly   345 EEVDYEFPLPGGDQLPPTHYHNRLGMCYEAEEVRNCILKGSTESDDFSHNESLLLANLMDTIHAE 409
            .....|||||  |...|.::.|..|:.|||||||.|:.||..||...|..:|.|:..:||....:
Zfish   262 NGQKSEFPLP--DPRLPLNFPNSTGLRYEAEEVRRCLQKGLKESIRMSLADSELVMEIMDEARRQ 324

  Fly   410 LGV 412
            :||
Zfish   325 VGV 327

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13280NP_609812.1 MviM 89..387 CDD:223745 112/302 (37%)
GFO_IDH_MocA 92..213 CDD:279716 48/120 (40%)
dhdhlNP_999900.1 MviM 1..326 CDD:223745 119/326 (37%)
GFO_IDH_MocA 4..124 CDD:279716 48/120 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C234868274
eggNOG 1 0.900 E1_COG0673
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D351032at33208
OrthoFinder 1 1.000 FOG0001785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22604
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.