DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13280 and CG3609

Sequence 1:NP_609812.1 Gene:CG13280 FlyBaseID:FBgn0032609 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001188684.1 Gene:CG3609 FlyBaseID:FBgn0031418 Length:335 Species:Drosophila melanogaster

Alignment Length:334 Identity:128/335 (38%)
Similarity:192/335 (57%) Gaps:23/335 (7%)


  Fly    92 LRWGIAPVSLMADDFAAALSVLPEQHHRIVSCVAAYQSHALAFAERHQVENVYTSFEDLAKCPNV 156
            :|||||....:::||..|||.||...|::.:..|.....|..||.:|.:.....|:|:|||..:|
  Fly     5 IRWGIASAGKISEDFVIALSTLPSSDHKVQAVAARALDRAQEFATKHGIPKALGSYEELAKSTDV 69

  Fly   157 DVVYISPLNPQHSELCHLMLNHDKHVLCEKPLCMTEEQVTKLLEKARARGLFLMEGMWPRCVPAY 221
            |||||..|||||.|:..||||:.|||||||||.|.::||..:|..|:|...|.||.:|.|..|:|
  Fly    70 DVVYIGTLNPQHYEVALLMLNNGKHVLCEKPLAMNKKQVEGILAAAKANKRFFMEAVWSRFFPSY 134

  Fly   222 HYLRHQILRNRLGEIKQVHCTLGLP------VSQGRLGLYGGVTNDFGVYGMQLALWVFREVPRC 280
            ..::..|...:||::|.|....|.|      :.:..||  |||..|.|:|.:|::.|.|:|.|..
  Fly   135 QRVKELISSGQLGQVKDVEVNFGFPMPHVDRLQKRELG--GGVVYDLGIYTIQVSQWAFQEKPEK 197

  Fly   281 LKVSGRVNSEHVDVSADIELCFTRGKRALIEVSSEKKLSNQAVIQGKDGSIKMNNYWCPTRLITE 345
            ::..|.:|:|.:|......|.::.|:.|.:..||::||.|.|||:|..|.:.:.::|.|.:||  
  Fly   198 IESKGTLNAEGIDDDVSATLTYSGGRTARMRFSSKEKLGNTAVIKGTKGQVTLIDFWSPNKLI-- 260

  Fly   346 EVDYEFPLPGGDQ--LPP-----THYHNRLGMCYEAEEVRNCILKGSTESDDFSHNESLLLANLM 403
            ::|      |.::  |||     |:|.|...|.||||.||..|:.|..|:.:.::.:||:.|.:.
  Fly   261 DID------GQEKEWLPPKGKYATNYANSEAMRYEAEAVRQSIIAGEVENKNVTYADSLIFAEIE 319

  Fly   404 DTIHAELGV 412
            |||..::||
  Fly   320 DTIRKQIGV 328

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13280NP_609812.1 MviM 89..387 CDD:223745 119/308 (39%)
GFO_IDH_MocA 92..213 CDD:279716 57/121 (47%)
CG3609NP_001188684.1 MviM 5..292 CDD:223745 115/297 (39%)
GFO_IDH_MocA 5..123 CDD:279716 55/118 (47%)
GFO_IDH_MocA_C 138..>198 CDD:304482 20/62 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C234880341
eggNOG 1 0.900 E1_COG0673
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 100 1.000 Inparanoid score I2115
Isobase 1 0.950 0 Normalized mean entropy S4313
OrthoDB 1 1.010 D351032at33208
OrthoFinder 1 1.000 FOG0001785
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22604
RoundUp 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.