DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13280 and CG17712

Sequence 1:NP_609812.1 Gene:CG13280 FlyBaseID:FBgn0032609 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_608619.1 Gene:CG17712 FlyBaseID:FBgn0027597 Length:384 Species:Drosophila melanogaster

Alignment Length:402 Identity:73/403 (18%)
Similarity:140/403 (35%) Gaps:115/403 (29%)


  Fly    76 KGILERGVWVVDEGPTLRWGIAPVSLMADDFAAALSVLPEQHHRIVSCVAAYQSHALAFAERHQV 140
            ||...|.:|    |.||:        .|.:.|...:|   |.|..|                   
  Fly    24 KGFEVRAIW----GRTLK--------EAKETATTQNV---QFHTNV------------------- 54

  Fly   141 ENVYTSFEDLAKCPNVDVVYISPLNPQHSELCHLMLNHDKHVLCEKPLCMTEEQVTKLLEKARAR 205
                  .:|:....:||:|:|......|:|:....|...|||:|:||..:.::...|::..::..
  Fly    55 ------IDDVLLRKDVDLVFIVCQPFLHAEISVKALGIGKHVVCDKPAGLHQQDALKMVRASQYY 113

  Fly   206 GLFLMEGMWP-RCVPAYHYLRHQILRNRLGEIKQVHCTLGLPVSQGRL-----------GLYGGV 258
            ...:.....| |.:||:.::|..:....:|.|..| ..:.:.|..|.|           .:.||.
  Fly   114 PTLISLVNHPLRFLPAFTHMRRCLQEELIGSIGDV-VLMDVRVQMGTLFPEKYNWMCDAQMGGGA 177

  Fly   259 TNDFGVYGMQLALWVFREVPRCLKVSGRVNSEHVDVSADIELCFTRGKRALIEV---------SS 314
            .|   :.|..:.|..|....:.::|.|.:.|            :|:...|:..:         :.
  Fly   178 LN---LVGSVVDLVTFLLQQQAIRVHGVLRS------------YTKTTPAINGIRQITAPDFCNF 227

  Fly   315 EKKLSNQAVIQGKDGSIKMNNYWCPTRLITEEV-----DYEFPLPGGD----------------Q 358
            :.:|::..::     ::.::::..|.:..::||     .....:.|||                .
  Fly   228 QMELASGTLV-----TVALHSHTVPAKAFSQEVLIYGSKGHLVVRGGDLFVLKEGQPKEEAVYVD 287

  Fly   359 LPPTHY--HNRL-------GMCYEAEEVRNCILKGSTESDDFSHNESLLLANLMDTIHAELGVGE 414
            :...|:  :|.|       |:|.....::...  ||.||.......| ..|...|.::.:..|..
  Fly   288 VQDLHFATNNSLLPRPYIKGLCKMVGALKEAF--GSKESSWVKAPVS-TAATFEDGLYVQAVVEA 349

  Fly   415 FANRNEVSDLQK 426
            ....||....|:
  Fly   350 IRKSNETRQWQR 361

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13280NP_609812.1 MviM 89..387 CDD:223745 60/349 (17%)
GFO_IDH_MocA 92..213 CDD:279716 22/121 (18%)
CG17712NP_608619.1 MviM 5..364 CDD:223745 73/403 (18%)
GFO_IDH_MocA 5..109 CDD:279716 28/125 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112817411
eggNOG 1 0.900 E1_COG0673
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.