DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13280 and Gfod2

Sequence 1:NP_609812.1 Gene:CG13280 FlyBaseID:FBgn0032609 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001100891.1 Gene:Gfod2 RGDID:1311198 Length:385 Species:Rattus norvegicus

Alignment Length:355 Identity:75/356 (21%)
Similarity:132/356 (37%) Gaps:66/356 (19%)


  Fly   128 QSHALAFAERHQVENVYTS-FEDLAKCPNVDVVYISPLNPQHSELCHLMLNHDKHVLCEKPLCMT 191
            :..|...||...: ..||| .:|:....:||:|.|:...|...::....|...|:|:|||  ..|
  Rat    38 EEEAKQLAEEMNI-TFYTSRTDDVLLHQDVDLVCINIPPPLTRQISVKALGIGKNVVCEK--AAT 99

  Fly   192 EEQVTKLLEKAR-ARGLFLMEGMWPRCVPAYHYLRHQILRNRLGEI----KQVHCTLGLPVSQGR 251
            .....:::..:| ...|..:.|...|.:||:..::..|..:.:|.:    .:::....|..|.|.
  Rat   100 SVDAFRMVTASRYYPQLMSLVGNVLRFLPAFVRMKQLIAEHYVGAVMICDARIYSGSLLSSSYGW 164

  Fly   252 LG---LYGGVTNDFGVYGMQLALWV----FREVPRCLKVSGRVNS-----EHV------------ 292
            :.   :.||..:..|.|.:.|...:    ..:|...||...|.|:     .||            
  Rat   165 ICDELMGGGGLHTMGTYIVDLLTHLTGQKAEKVHGLLKTFVRQNATIRGIRHVTSDDFCFFQMLM 229

  Fly   293 --DVSADIELCFTRGKRALIEV----SSEKKLSNQAVIQGKDGSIKMNNYWCPTRLITEEVDYEF 351
              .|.:.:.|.|......:.||    |:.:.::..|.:.|:..|......     |:.:.:....
  Rat   230 GGGVCSTVTLNFNMPGAFVHEVMVVGSAGRLVARGADLYGQKNSAAQEEL-----LVRDSLAVGA 289

  Fly   352 PLP-GGDQLPPTHYHNRLGMCYEAEEVRNCIL-KGSTESDD-------FSHNESLLLANLMDTIH 407
            .|| .|.|..|..|..  ||.|..:.:|.... :|...:.|       .|..:.|.:.:::|.|.
  Rat   290 GLPEQGPQDVPLLYLK--GMVYMVQALRQSFQGQGDRRTWDRTPVSMAASFEDGLYMQSVVDAIK 352

  Fly   408 AELGVGEF-----------ANRNEVSDLQK 426
            .....||:           ||:|....||:
  Rat   353 RSSRSGEWETVELLTEEPDANQNLSETLQR 382

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13280NP_609812.1 MviM 89..387 CDD:223745 63/297 (21%)
GFO_IDH_MocA 92..213 CDD:279716 22/87 (25%)
Gfod2NP_001100891.1 MviM 7..365 CDD:223745 70/337 (21%)
GFO_IDH_MocA 7..111 CDD:279716 19/76 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0673
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.