DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13280 and DHDH

Sequence 1:NP_609812.1 Gene:CG13280 FlyBaseID:FBgn0032609 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_055290.1 Gene:DHDH HGNCID:17887 Length:334 Species:Homo sapiens

Alignment Length:329 Identity:117/330 (35%)
Similarity:172/330 (52%) Gaps:12/330 (4%)


  Fly    92 LRWGIAPVSLMADDFAAALSVLPEQHHRIVSCVAAYQSHALAFAERHQVENVYTSFEDLAKCPNV 156
            |||||..|.|::.||.|.|..||...|::|:..|...|.|..||::|.:...|.|:|:|||.|:|
Human     3 LRWGIVSVGLISSDFTAVLQTLPRSEHQVVAVAARDLSRAKEFAQKHDIPKAYGSYEELAKDPSV 67

  Fly   157 DVVYISPLNPQHSELCHLMLNHDKHVLCEKPLCMTEEQVTKLLEKARARGLFLMEGMWPRCVPAY 221
            :|.||...:|||.....|.|...|.||||||..:...:|.:::.:||:|.|||||.:|.|..||.
Human    68 EVAYIGTQHPQHKAAVMLCLAAGKAVLCEKPTGVNAAEVREMVAEARSRALFLMEAIWTRFFPAS 132

  Fly   222 HYLRHQILRNRLGEIKQVHCTLG-----LPVSQGRLGLYGGVTNDFGVYGMQLALWVF-REVPRC 280
            ..||..:.:..||:::......|     :|.:..| ...||...|.|:|.:|....|| .:.|..
Human   133 EALRSVLAQGTLGDLRVARAEFGKNLIHVPRAVDR-AQAGGALLDIGIYCVQFTSMVFGGQKPEK 196

  Fly   281 LKVSGRVNSEHVDVSADIELCFTRGKRALIEVSSEKKLSNQAVIQGKDGSIK-MNNYWCPTRLIT 344
            :.|.||.:...||.:..:.|.:..........|...:|||.|.:.|..|.:: :|..||||.|:.
Human   197 ISVVGRRHETGVDDTVTVLLQYPGEVHGSFTCSITVQLSNTASVSGTKGMVQLLNPCWCPTELVV 261

  Fly   345 EEVDYEFPLPGGDQLP-PTHYHNRLGMCYEAEEVRNCILKGSTESDDFSHNESLLLANLMDTIHA 408
            :....|||||   .:| ..::.|..||.|||:.|..|:.||..||.....:||.|||::::.:..
Human   262 KGEHKEFPLP---PVPKDCNFDNGAGMSYEAKHVWECLRKGMKESPVIPLSESELLADILEEVRK 323

  Fly   409 ELGV 412
            .:||
Human   324 AIGV 327

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13280NP_609812.1 MviM 89..387 CDD:223745 108/303 (36%)
GFO_IDH_MocA 92..213 CDD:279716 53/121 (44%)
DHDHNP_055290.1 MviM 1..326 CDD:223745 115/327 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C234869708
eggNOG 1 0.900 E1_COG0673
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S4313
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D351032at33208
OrthoFinder 1 1.000 FOG0001785
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22604
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.