DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13280 and SPAC513.06c

Sequence 1:NP_609812.1 Gene:CG13280 FlyBaseID:FBgn0032609 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_593980.1 Gene:SPAC513.06c PomBaseID:SPAC513.06c Length:368 Species:Schizosaccharomyces pombe

Alignment Length:377 Identity:113/378 (30%)
Similarity:159/378 (42%) Gaps:82/378 (22%)


  Fly    90 PTLRWGIAPVSLMADDFAAALSVLPEQH---HRIVSCVAAYQSH-ALAFAERHQV---ENVYTSF 147
            |.:.||......:|..||..|..:||:|   |.||:.......| |.:||:.|..   ...|.|:
pombe     9 PVIHWGFLGAGSIAAVFAKDLVGVPERHKVQHEIVAVATRDSEHRASSFAKNHCAPCKPKAYGSY 73

  Fly   148 EDLAKCPNVDVVYISPLNPQHSELCHLMLNHDKHVLCEKPLCMTEEQVTKLLEKARARGLFLMEG 212
            |:|.|...||:||||..:|||.|:..|.|.:||.|||||||.:...:..:|:|.||||.||..||
pombe    74 EELVKDDKVDIVYISSTHPQHYEVVKLALLNDKAVLCEKPLTINYPEALELVELARARNLFFAEG 138

  Fly   213 MWPRCVPAYHYLRHQILRNRL-GEIKQVHCTLGLPVSQ----------GRL---GLYGGVTNDFG 263
            .|.|..|.....:..:..:|: |:    |..|.:..||          .||   .|..||..|.|
pombe   139 FWIRFYPIVKAAKTLLHEDRVCGD----HFRLFVDFSQDFRFRELPSESRLRTVSLGAGVLLDMG 199

  Fly   264 VYGMQLALWVFREVPRCLKVSGRVNSEHV---DVSADI------------------ELC--FTRG 305
            ||.:..:..:..:.|:..|....|:|..:   |.:.||                  .||  ..||
pombe   200 VYPLTWSRLLLYDDPKNEKQEPTVSSNALTFEDHNGDIGDYTTAVTLVFPKTESIAMLCTSMDRG 264

  Fly   306 KRA--LIEVSSEKKLSNQAVIQG---KDGSIKMNNYWCPTRLI-----TEEVDYEFPLPGGDQLP 360
            |.:  .:::..|.  .||..|.|   :..|||         ||     ||..|:.|         
pombe   265 KMSDDFLKLDGEN--GNQLFISGDCYRPQSIK---------LIRASGETEVFDFSF--------- 309

  Fly   361 PTHYHNRLGMCYEAEEVRNCILKGSTESDDFSHNESLLLANLMDTIHAELGV 412
                .:..|..||.:.|..|:||...|:.:..|.|:|.:..|.|.|..::.|
pombe   310 ----DDATGFFYEQDAVAECLLKNMKEAPEIPHEETLKMMQLTDQIRRQINV 357

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13280NP_609812.1 MviM 89..387 CDD:223745 105/351 (30%)
GFO_IDH_MocA 92..213 CDD:279716 53/128 (41%)
SPAC513.06cNP_593980.1 MviM 8..355 CDD:223745 112/374 (30%)
GFO_IDH_MocA 11..139 CDD:279716 53/128 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I1323
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001785
OrthoInspector 1 1.000 T631408
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22604
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
77.120

Return to query results.
Submit another query.