DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13280 and Blvra

Sequence 1:NP_609812.1 Gene:CG13280 FlyBaseID:FBgn0032609 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_446302.1 Gene:Blvra RGDID:620721 Length:295 Species:Rattus norvegicus

Alignment Length:373 Identity:69/374 (18%)
Similarity:135/374 (36%) Gaps:116/374 (31%)


  Fly    86 VDEGPTLRWGIAPVSL----------MADDFAAALSVLPEQHHRIVSCVAAYQSHALAFAERHQV 140
            :|..|..::|:..|.:          :.|..:||...|                  :.|..|.::
  Rat     1 MDAEPKRKFGVVVVGVGRAGSVRLRDLKDPRSAAFLNL------------------IGFVSRREL 47

  Fly   141 ENV----YTSFEDLAKCPNVDVVYISPLNPQHSELCHLMLNHDKHVLCEKPLCMTEEQVTKLLEK 201
            .::    ..|.||..:...:||.||...:..|.:.....|...||||.|.|:.::.....:|.|.
  Rat    48 GSLDEVRQISLEDALRSQEIDVAYICSESSSHEDYIRQFLQAGKHVLVEYPMTLSFAAAQELWEL 112

  Fly   202 ARARGLFLMEGMWPRCVPAYHYLRHQILRNRL--GEIKQVHCTLGLPVSQGRLGLYGGVTNDFGV 264
            |..:|..|.|......:..:.:||.::|...|  |.::    ....|:.:.|.|        |..
  Rat   113 AAQKGRVLHEEHVELLMEEFEFLRREVLGKELLKGSLR----FTASPLEEERFG--------FPA 165

  Fly   265 Y-GMQLALWVFREVPRCLKVSGRVNSEHVDVSADIELCFTRGKRALIEVSSEKKLSNQAV---IQ 325
            : |:....|:       :.:.|.::.    :||.:|   .|.:...::::.:.:..|:.:   |:
  Rat   166 FSGISRLTWL-------VSLFGELSL----ISATLE---ERKEDQYMKMTVQLETQNKGLLSWIE 216

  Fly   326 GKDGSIKMNNYWCPTRLITEEVDYEFPLPGGDQLPPTHYHNRLGMCYEAEEVRNCILKGSTESDD 390
            .|...:|.|.|          |:::|.....:::|....:            :|..||       
  Rat   217 EKGPGLKRNRY----------VNFQFTSGSLEEVPSVGVN------------KNIFLK------- 252

  Fly   391 FSHNESLLLANLMDTIHAE------------LGVGEFANRNEVSDLQK 426
               ::.:.:..|:|.:.||            ||:        .||:||
  Rat   253 ---DQDIFVQKLLDQVSAEDLAAEKKRIMHCLGL--------ASDIQK 289

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13280NP_609812.1 MviM 89..387 CDD:223745 58/318 (18%)
GFO_IDH_MocA 92..213 CDD:279716 29/135 (21%)
BlvraNP_446302.1 GFO_IDH_MocA 18..124 CDD:279716 27/124 (22%)
MviM 57..>139 CDD:223745 23/82 (28%)
Biliv-reduc_cat 132..242 CDD:286275 25/146 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0673
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.