DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13280 and dhdh

DIOPT Version :9

Sequence 1:NP_609812.1 Gene:CG13280 / 35015 FlyBaseID:FBgn0032609 Length:473 Species:Drosophila melanogaster
Sequence 2:NP_001120637.1 Gene:dhdh / 100145807 XenbaseID:XB-GENE-5788276 Length:334 Species:Xenopus tropicalis


Alignment Length:328 Identity:119/328 - (36%)
Similarity:178/328 - (54%) Gaps:12/328 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 RWGIAPVSLMADDFAAALSVLPEQHHRIVSCVAAYQSHALAFAERHQVENVYTSFEDLAKCPNVD 157
            :|||.....:::||..||..||.|.|::|:..|.....|..||:..::...|.|:|:|||.||:|
 Frog     4 KWGICSTGKISNDFLVALETLPAQDHQVVAVAARDLKQARDFAQIRKIPKAYGSYEELAKDPNID 68

  Fly   158 VVYISPLNPQHSELCHLMLNHDKHVLCEKPLCMTEEQVTKLLEKARARGLFLMEGMWPRCVPAYH 222
            |:|:..|:..|.::..:.|.:.|:|||||||.|...:|.:|...|||..:|.||.:|.|..|.|.
 Frog    69 VIYVGVLHTVHRDVVLMFLQNKKNVLCEKPLAMNSAEVQELTSAARAYNVFFMEALWSRFFPVYE 133

  Fly   223 YLRHQILRNRLGEIKQVHCTLG-----LP-VSQGRLGLYGGVTNDFGVYGMQLALWVFR-EVPRC 280
            .:|..:.:|.:|::|.|....|     :| ..|..||  ||...|.|.|.:|.||.||. |.|..
 Frog   134 QIRTLLSQNAIGDVKVVRAEFGSNQHHVPRAVQKELG--GGALLDIGCYCIQFALMVFNGEKPES 196

  Fly   281 LKVSGRVNSEHVDVSADIELCFTRGKRALIEVSSEKKLSNQAVIQGKDGSIKMNN-YWCPTRLIT 344
            :...|.:....||.:..|.|.:...::|::..:....:.|||.|.|..|.|::.: .||||.:|.
 Frog   197 VTAKGFLYDTGVDETVTIILQYPGKRQAILTCTIMAAMPNQAAICGSKGMIQVPSCMWCPTSVIV 261

  Fly   345 EEVDYEFPLPGGDQLPPTHYHNRLGMCYEAEEVRNCILKGSTESDDFSHNESLLLANLMDTIHAE 409
            ...:.:||||...:  |.|:.|..|:.||||.||.|:|||..||......:|.||:::||.:..:
 Frog   262 NGKETKFPLPHSTK--PMHFTNSTGLSYEAEHVRQCLLKGLKESPIMRLKDSELLSSIMDEVRGQ 324

  Fly   410 LGV 412
            |||
 Frog   325 LGV 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13280NP_609812.1 MviM 89..387 CDD:223745 109/301 (36%)
GFO_IDH_MocA 92..213 CDD:279716 47/119 (39%)
dhdhNP_001120637.1 MviM 1..302 CDD:223745 109/301 (36%)
GFO_IDH_MocA 4..121 CDD:279716 45/116 (39%)
GFO_IDH_MocA_C 136..>201 CDD:304482 22/66 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57478
OrthoDB 1 1.010 - - D351032at33208
OrthoFinder 1 1.000 - - FOG0001373
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22604
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X868
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.030

Return to query results.
Submit another query.