DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ChLD3 and serp

Sequence 1:NP_609806.1 Gene:ChLD3 FlyBaseID:FBgn0032598 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_001262062.1 Gene:serp FlyBaseID:FBgn0260653 Length:541 Species:Drosophila melanogaster

Alignment Length:478 Identity:225/479 (47%)
Similarity:301/479 (63%) Gaps:20/479 (4%)


  Fly   111 CAKYFLCLDGEVFEFKCSEGLLFDVVRQICDFKANVDNCDVSAETPAPKPLLEMAD--CADEYQL 173
            |.....|....:...:|..||.||:.:|.||:|.:|.||....:....||||...:  |.|.: |
  Fly    67 CRDVIQCTSSGLQAIRCPAGLYFDIEKQTCDWKESVKNCKSKNKERRVKPLLHTDEPLCQDGF-L 130

  Fly   174 GCADGTCLPQEYFCDGSVDCPDGSDEGWCDVEHDPNAAGACDPRKCHLPQCFCSKDGTQIPGSLP 238
            .|.||.|:.:..||:|..||.|||||..||:::|||.|..|||..|.||.||||:|||.|||.||
  Fly   131 ACGDGNCIERGLFCNGEKDCSDGSDENTCDIDNDPNRAPPCDPAVCVLPDCFCSEDGTSIPGDLP 195

  Fly   239 AQSVPQMILLTFDDAINHDNWELFSKVLFTQHRRNPNGCPIKGTFYVSHPFTNYQYVQKLWNDGH 303
            |:.||.||.:|||||||::|.||:.::.  :.|:|||||.||.|::|||.:|||..||:....||
  Fly   196 AKDVPMMITITFDDAINNNNIELYKEIF--KDRKNPNGCSIKATYFVSHKYTNYSAVQETARKGH 258

  Fly   304 EIAVHSVTHRGPEMWWSKNATIEDWFDEMVGQANIINKFAAVRMEEIRGMRVPFLRVGWNRQFLM 368
            ||||||:||...|.:|| |||::||..||.|...|..|||.:....:.|:|.|:||||.|.||.|
  Fly   259 EIAVHSITHNDEERFWS-NATVDDWAKEMAGMRIITEKFANITDNSVVGVRAPYLRVGGNNQFTM 322

  Fly   369 MKEFGFVYDSSMVAPHSNPPLWPYTLDYKMPHSCTGVNQNCPSRSYPGIWELVMNQLE------V 427
            |:|..|:|||::.||.|||||||||:.::|||.|.|..|:||:||: .:||:|||:|:      .
  Fly   323 MEEQAFLYDSTITAPLSNPPLWPYTMYFRMPHRCHGNLQSCPTRSH-AVWEMVMNELDRREDPVN 386

  Fly   428 GEYM--CGMVDTCPPHLSGEDVYRMLTHNFKRHYLSNRAPFGLYFHSTWFK-KVDYLNAFLKFLD 489
            .||:  |.|||:|...|:|:..|..|.|||.|||..||||.|||||:.|.| ..::|:|||.::|
  Fly   387 DEYLPGCAMVDSCSNILTGDQFYNFLNHNFDRHYDQNRAPLGLYFHAAWLKNNPEFLDAFLYWID 451

  Fly   490 D-LQKLPDVFFVTNQQAIQWMRHPTPSNQLHQFESWHCQPKDLDPHEQVCNTPNVCKVRSR-VLQ 552
            : |....||:|||..|.||||::|...:::..||.|  :.|.:...:..|..||.||:.|: |..
  Fly   452 EILANHNDVYFVTMTQVIQWMQNPRTISEVKNFEPW--REKCVVEGKPACWVPNTCKLTSKEVPG 514

  Fly   553 EDRFFYTCMECPAQYPWIRNEFG 575
            |.....||:.||..|||:.:..|
  Fly   515 ETINLQTCVRCPNNYPWVSDPTG 537

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ChLD3NP_609806.1 CBM_14 <111..149 CDD:279884 13/38 (34%)
LDLa 168..202 CDD:238060 16/34 (47%)
CE4_CDA_like_1 243..512 CDD:200596 143/279 (51%)
serpNP_001262062.1 CBM_14 48..105 CDD:279884 13/38 (34%)
LDLa 125..159 CDD:238060 17/35 (49%)
CE4_CDA_like_1 200..475 CDD:200596 143/279 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005349
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45985
RoundUp 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.