DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ChLD3 and verm

Sequence 1:NP_609806.1 Gene:ChLD3 FlyBaseID:FBgn0032598 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_001163469.1 Gene:verm FlyBaseID:FBgn0261341 Length:555 Species:Drosophila melanogaster

Alignment Length:565 Identity:238/566 (42%)
Similarity:329/566 (58%) Gaps:57/566 (10%)


  Fly    49 WMMVALMIMSSSLDALVIDNDGIVGNQTRHRRSTSGAASCMQDARFYRNP--------------- 98
            |.:::::.:..::|.|.:.|            |...|.......|:.|.|               
  Fly     5 WPILSVVCLCLAVDGLYVKN------------SFEPAIDQDPSRRYQRKPHGQDKLEGVDVEEVC 57

  Fly    99 -NRPV---HKIWTNSECAKYFLC----LDG--EVFEFKCSEGLLFDVVRQICDFKANVDNCDVSA 153
             :||.   .::.|:.:|.:.:.|    .||  .:...:|:.||.|||:||:||:|:||.:|||..
  Fly    58 ADRPADEYFRLETDGDCREVYRCDSAGEDGTWRLAPIRCAGGLAFDVLRQLCDWKSNVKSCDVLE 122

  Fly   154 ETPAPKPLLEMAD-CADEYQLGCADGTCLPQEYFCDGSVDCPDGSDEGWCDVEHDPNAAGACDPR 217
            :....||:|:..: ...|.:|.|.||.||.:|.||:|..||.|.|||..|.|:.|||.|..|||.
  Fly   123 KPRKAKPILKTDEPICPEGKLSCGDGECLDKELFCNGKSDCKDESDENACSVDEDPNRAPECDPT 187

  Fly   218 KCHLPQCFCSKDGTQIPGSLPAQSVPQMILLTFDDAINHDNWELFSKVLFTQHRRNPNGCPIKGT 282
            :|.||.||||.|||:|||.:..|.|||||.:||:.|:|.||.:|:..: |...|:|||||.||||
  Fly   188 QCALPDCFCSADGTRIPGGIEPQQVPQMITITFNGAVNVDNIDLYEDI-FNGQRQNPNGCSIKGT 251

  Fly   283 FYVSHPFTNYQYVQKLWNDGHEIAVHSVTHRGPEMWWSKNATIEDWFDEMVGQANIINKFAAVRM 347
            |:|||.:|||..||.|...||||:|.|:||:....:|: ..:.:||..||.|...|:.:||.:..
  Fly   252 FFVSHKYTNYSAVQDLHRRGHEISVFSLTHKDDPNYWT-GGSYDDWLAEMAGSRLIVERFANITD 315

  Fly   348 EEIRGMRVPFLRVGWNRQFLMMKEFGFVYDSSMVAPHSNPPLWPYTLDYKMPHSCTGVNQNCPSR 412
            ..|.|||.|:||||.|:||.||.:..||||:|:.|.....|:|||||.::|||.|.|...|||||
  Fly   316 GSIIGMRAPYLRVGGNKQFEMMADQFFVYDASITASLGRVPIWPYTLYFRMPHKCNGNAHNCPSR 380

  Fly   413 SYPGIWELVMNQLE------VGEYM--CGMVDTCPPHLSGEDVYRMLTHNFKRHYLSNRAPFGLY 469
            |:| :||:|||:|:      ..|.:  |.|||:|....||:...|:|.|||.|||.|||||.||:
  Fly   381 SHP-VWEMVMNELDRRDDPTFDESLPGCHMVDSCSNVASGDQFARLLRHNFNRHYNSNRAPLGLH 444

  Fly   470 FHSTWFK-KVDYLNAFLKFLDDLQKLPDVFFVTNQQAIQWMRHPTPSNQLHQFESW--HCQPKDL 531
            ||::|.| |.:|.:..:||::::....|||||||.|.||||::||..|.|..|:.|  .|..|. 
  Fly   445 FHASWLKSKKEYRDELIKFIEEMLGRNDVFFVTNLQVIQWMQNPTELNSLRDFQEWKEKCDVKG- 508

  Fly   532 DPHEQVCNTPNVCKVRSRVLQ-EDRFFYTCMECPAQYPWIRNEFG 575
               :..|:.||.|.:.:|.|. |....:||||||..||||.:..|
  Fly   509 ---QPYCSLPNACPLTTRELPGETLRLFTCMECPNNYPWILDPTG 550

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ChLD3NP_609806.1 CBM_14 <111..149 CDD:279884 17/44 (39%)
LDLa 168..202 CDD:238060 17/34 (50%)
CE4_CDA_like_1 243..512 CDD:200596 136/278 (49%)
vermNP_001163469.1 CBM_14 57..118 CDD:279884 20/61 (33%)
LDLa 138..172 CDD:238060 17/34 (50%)
CE4_CDA_like_1 213..488 CDD:200596 136/278 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005349
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45985
RoundUp 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.