DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ChLD3 and Cda9

Sequence 1:NP_609806.1 Gene:ChLD3 FlyBaseID:FBgn0032598 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_001286519.1 Gene:Cda9 FlyBaseID:FBgn0034197 Length:397 Species:Drosophila melanogaster

Alignment Length:385 Identity:140/386 (36%)
Similarity:196/386 (51%) Gaps:49/386 (13%)


  Fly   211 AGACDPRKCHLPQCFCSKDGTQIPGSLPA-------QSVPQMILLTFDDAINHDNWE----LFSK 264
            |..|.|.||.||.|.||      ..:||.       ..:||.:.:|||||:|..|:.    ||..
  Fly    39 AEPCKPSKCKLPDCRCS------DAALPTSKFQGKENQIPQFVTITFDDAVNAVNFAQYELLFDG 97

  Fly   265 VLFTQHRRNPNGCPIKGTFYVSHPFTNYQYVQKLWNDGHEIAVHSVTH-RGPEMWWSKNA-TIED 327
            ::      ||:||...|||::||.:|:|..|..|:..|||||:||||| .|.:.|.|.:. ||| 
  Fly    98 LI------NPDGCGAAGTFFLSHEYTDYVRVNALYRAGHEIALHSVTHGDGTDYWRSADVPTIE- 155

  Fly   328 WFDEMVGQANIINKFAAVRMEEIRGMRVPFLRVGWNRQFLMMKEFGFVYDSSM-VAPHSNPPLWP 391
              .|...|..::..||.|..::|:|||:|||::..|..|...:..|..||||. .....:|.:||
  Fly   156 --REFGAQLKMLETFAKVNPKKIQGMRLPFLQISGNNTFEAARRLGLTYDSSWPTQKFKDPAMWP 218

  Fly   392 YTLDYKMPHSC-TGVNQNCPSRSYPGIW-ELVMNQLEVGEYMCGMVDTC--PPHLSGEDVYRMLT 452
            ||||||....| .|   .||..|.||.| ..::...:...|.|.|:|.|  ||....::::..:.
  Fly   219 YTLDYKSKQDCQIG---PCPEASIPGFWVNPMVTWTDTEGYSCSMIDACVYPPEDDMDELFDWMM 280

  Fly   453 HNFKRHYLSNRAPFGLYFHSTWFKK-VDYLNAFLKFLDDLQKLPDVFFVTNQQAIQWMRHPTPSN 516
            .||.||||.||||||:|.|:.||.: .:|..||.||::.|....||:|....:.::::|.||..:
  Fly   281 ENFNRHYLGNRAPFGMYLHAAWFSRGRNYFGAFKKFINHLNTYSDVYFTGISRMLEYVRKPTLGS 345

  Fly   517 QLHQFESWHCQPKDL-DPHEQVCNTPNVCKVRSRVLQEDRFFYTCMECPAQYPWIRNEFG 575
            ..          ||. |..|..|.... |.|:.....|:|:...|.:||:.|||:.|..|
  Fly   346 PF----------KDCPDLPEAECRAVQ-CHVQKMSTGEERYMTVCDKCPSVYPWLDNPLG 394

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ChLD3NP_609806.1 CBM_14 <111..149 CDD:279884
LDLa 168..202 CDD:238060
CE4_CDA_like_1 243..512 CDD:200596 109/281 (39%)
Cda9NP_001286519.1 CE4_CDA_like_2 72..341 CDD:200597 109/281 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005349
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45985
RoundUp 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.