DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ChLD3 and F48E3.8

Sequence 1:NP_609806.1 Gene:ChLD3 FlyBaseID:FBgn0032598 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_741840.2 Gene:F48E3.8 WormBaseID:WBGene00018607 Length:2444 Species:Caenorhabditis elegans

Alignment Length:559 Identity:162/560 (29%)
Similarity:241/560 (43%) Gaps:114/560 (20%)


  Fly    82 TSGAASCMQDARF-YRNPNRPVHKIWTNSECAKYFLCLDGEVFEFKCSEGLLFDVVRQICDF--- 142
            :|..:||:.:.|: .|:.:.|......:|||....:|:|.     :|:.....:::..:|..   
 Worm  1930 SSDRSSCVLNDRYNVRSRSYPKTFCTFDSECTGGSICIDK-----RCACRNDHEMINGVCQLANL 1989

  Fly   143 ---KANVDNCDVSAETPAPKPLLEMADCADEYQLGCADGTCL-PQEYFCDGSVDCPDGSDE---- 199
               :.:...|...||                    |.:|.|: .:..:.|.::||....:.    
 Worm  1990 PGSRCHTSFCSKGAE--------------------CRNGYCVCAKTNYSDSTLDCVSSINANQGS 2034

  Fly   200 ----------------------GWC-----DVEHDPN------------------AAGACDPR-- 217
                                  |:|     :::.:.|                  ....| ||  
 Worm  2035 MAYPGSKCNATTSCQQNSSCFFGYCVTPQDEIDREANIKIRHIEKKQTRRRQPSRLLTEC-PRDG 2098

  Fly   218 KCHLPQCFCSKDGTQIPGSLPAQSVPQMILLTFDDAINHDNWELFSKVLFTQHRRNPNGCPIKGT 282
            .|.||.|||:..|...|.:...:.||||::|:|||.|. |......|.||:...||||||.||||
 Worm  2099 SCRLPSCFCTSTGKIPPNNFDTKQVPQMVMLSFDDPIT-DRIINTLKSLFSGSIRNPNGCAIKGT 2162

  Fly   283 FYVSHPFTNYQYVQKLW--NDGHEIAVHSVTHRGPEMWWSKNATIEDWFDEMVGQANIINKFAAV 345
            |:|||.:.||.  |.||  :..|||.|:|:|...     ....|.|.|:.|..|....:.:|:.:
 Worm  2163 FFVSHQWNNYD--QSLWLHSTNHEIGVNSITRED-----LSGRTQERWYKEQKGMRETLAEFSFI 2220

  Fly   346 RMEEIRGMRVPFLRVGWNRQFLMMKEFGFVYDSSMVAPHSNPPLWPYTLDYKMPHSCTGVNQNCP 410
            ....|.|.|.|.|::|.:.|:.||.|..|.:|:||:.   :.|.||.|||:|:...|.|   |||
 Worm  2221 DRSHIIGTRAPELKIGGDAQYRMMSENNFTFDNSMLV---SSPYWPQTLDHKLAWECDG---NCP 2279

  Fly   411 SRSYPGIWELVMNQLEVGE--YMCGMVDTCPPHLSGEDVYRMLTHNFKRHYLSNRAPFGLYFHST 473
            ::|:..|||:.:..::..:  :...:.....|..|.:.|.:||..||..||.:|||||.|...:.
 Worm  2280 TQSHKAIWEIPIQNIQANDTRWYKTLTRAMKPFDSRDSVTKMLQRNFMNHYKTNRAPFILTLDTE 2344

  Fly   474 WFK------KVDYLNAFLKFLDDLQKLPDVFFVTNQQAIQWMRHPTPSNQLHQFESWHCQPKDLD 532
            :..      .|..|..||||:  :|| .|||.||..|.|.:||:|...|.:....||.|:|:..|
 Worm  2345 FLTYLPDNGAVYALRDFLKFI--VQK-QDVFVVTGSQIIDYMRNPVDLNNIKSLRSWQCKPQMKD 2406

  Fly   533 PHEQVCNTPNVCKVRSRVL-QEDRFFYTCMECPAQYPWI 570
             ....|..|..|....|.. |....|..|..||..||||
 Worm  2407 -EANPCENPTTCSFSGRARGQFAHSFRMCGVCPKSYPWI 2444

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ChLD3NP_609806.1 CBM_14 <111..149 CDD:279884 5/44 (11%)
LDLa 168..202 CDD:238060 7/61 (11%)
CE4_CDA_like_1 243..512 CDD:200596 105/279 (38%)
F48E3.8NP_741840.2 EB 85..141 CDD:279949
EB 211..267 CDD:279949
EB 287..338 CDD:279949
EB 327..379 CDD:279949
EB <424..463 CDD:279949
EB 501..550 CDD:279949
EB 539..594 CDD:279949
EB 583..637 CDD:279949
EB 626..679 CDD:279949
EB 668..721 CDD:279949
EB 800..852 CDD:279949
EB 964..1022 CDD:279949
EB <1114..1153 CDD:279949
EB 1286..1343 CDD:279949
EB 1416..1476 CDD:279949
EB 1465..1520 CDD:279949
EB 1760..1815 CDD:279949
EB <1896..1933 CDD:279949 1/3 (33%)
CE4_SF 2124..2386 CDD:301698 105/279 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005349
OrthoInspector 1 1.000 T98003
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45985
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R17034
TreeFam 1 0.960
55.090

Return to query results.
Submit another query.