DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ChLD3 and lgx-1

Sequence 1:NP_609806.1 Gene:ChLD3 FlyBaseID:FBgn0032598 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_741795.2 Gene:lgx-1 WormBaseID:WBGene00002983 Length:1884 Species:Caenorhabditis elegans

Alignment Length:559 Identity:170/560 (30%)
Similarity:256/560 (46%) Gaps:108/560 (19%)


  Fly    82 TSGAASCMQDARFYRNPNRPVHKIWTNSEC----AKYFL------CLDGEVFEFKCSEGLLFD-- 134
            |:|...|            |.:.|..|.:|    .|:.:      |.:||:    |:.|.:.|  
 Worm  1366 TNGFCHC------------PENYIRQNGQCISKECKHKVAKVGETCKNGEI----CAGGSICDYD 1414

  Fly   135 -----------VVRQICD------FKANVDNCDVSAETPAPKPLLE-MADCADEYQLGCADGTCL 181
                       .:|.||.      |.|..|.|.:..:........| |..|.|.:  ...||.|.
 Worm  1415 RKRCICAAQHVAIRGICKQKSAPAFAAPGDTCSMREKCTGGATCFEGMCTCDDHH--FAEDGYCR 1477

  Fly   182 PQE------YFCDG------SVDCPDGSDEGWCDVEHDPNAAGACDPRKCHLPQCFCSKDGTQIP 234
            |.|      .|.:|      |:..|            :...|.||:..:|.||.|||:::|.:.|
 Worm  1478 PIEARSSKVQFVNGAGLRFSSMQVP------------NRQRAQACNEAECKLPNCFCTENGRRAP 1530

  Fly   235 GSLPAQSVPQMILLTFDDAINHDNWELFSKVLFTQHRRNPNGCPIKGTFYVSHPFTNYQYVQKLW 299
            |.|.....||.::||||||:|...:..:.|:......:|||||.:|.||::||.:|||..|..|.
 Worm  1531 GGLRPDETPQFVVLTFDDAVNGKTFSDYKKLFENDVLKNPNGCDVKATFFISHEWTNYDAVNWLV 1595

  Fly   300 NDGHEIAVHSVTHRGPEMWWSKNATIEDWFDEMVGQANIINKFAAVRMEEIRGMRVPFLRVGWNR 364
            ....|||.:|::|...|     ||....|.:||.||..|:.||.....|||.|:|.|.|.:|.:.
 Worm  1596 QKNMEIASNSISHESLE-----NANTNRWLNEMDGQRRILAKFGGAPEEEIVGIRSPQLALGGDN 1655

  Fly   365 QFLMMKEFGFVYDSSMVAPHSNP-----PLWPYTLDYKMPHSCTGVNQNCPSRSYPGIWELVMNQ 424
            ||.||....|::|:||.|   ||     |.||.|:||::...|.  ..:||..|:||:|.:.:||
 Worm  1656 QFEMMIGAEFLWDNSMSA---NPGIHGEPFWPQTMDYQVAWDCN--EASCPKSSFPGVWSVPLNQ 1715

  Fly   425 LEVGEYMCGMVDT--------CPPHLSG--EDVYRMLTHNFKRHYLSNRAPFGLYFHSTWFKKVD 479
            . .|.|| ..:|:        ....|:.  :::..::|.||:|.|.:||||:.|..::.:.:...
 Worm  1716 F-YGSYM-SQIDSFRRSSMLRAAVDLNNTVDELEEIITRNFERSYSANRAPYVLSLNADFLQLGG 1778

  Fly   480 Y---LNAFLKFLDDLQKLPDVFFVTNQQAIQWMRHPTPSNQLHQFESWHCQPKDL----DPHEQV 537
            :   :.|..|||:.:....||:.||.:|.|.||:.|.|.:::...::..| |..|    :|....
 Worm  1779 HNKGMKAVQKFLNRMSAQKDVYIVTIKQLIDWMKRPVPISEMKSSKAVGC-PITLSFNRNPSLST 1842

  Fly   538 CNTPNVCKVRSRVL-QEDRFFYTCMECPAQYPWIRNEFG 575
            |:.||.|...:..| .::..|.||:.||..|||:.|..|
 Worm  1843 CDIPNKCLYSTPSLSSQEHQFLTCLPCPTMYPWLENPAG 1881

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ChLD3NP_609806.1 CBM_14 <111..149 CDD:279884 14/67 (21%)
LDLa 168..202 CDD:238060 10/46 (22%)
CE4_CDA_like_1 243..512 CDD:200596 102/287 (36%)
lgx-1NP_741795.2 EB <343..382 CDD:279949
EB 565..620 CDD:279949
EB 609..666 CDD:279949
EB <718..757 CDD:279949
EB 911..967 CDD:279949
EB 956..1020 CDD:279949
EB 1009..1083 CDD:279949
EB <1345..1383 CDD:279949 6/29 (21%)
EB 1372..1431 CDD:279949 14/75 (19%)
EB 1420..1476 CDD:279949 13/58 (22%)
CE4_CDA_like_1 1539..1814 CDD:200596 102/287 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005349
OrthoInspector 1 1.000 T98003
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45985
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.100

Return to query results.
Submit another query.