DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17904 and CFD1

Sequence 1:NP_609805.1 Gene:CG17904 FlyBaseID:FBgn0032597 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_012263.1 Gene:CFD1 SGDID:S000001265 Length:293 Species:Saccharomyces cerevisiae

Alignment Length:263 Identity:119/264 (45%)
Similarity:165/264 (63%) Gaps:21/264 (8%)


  Fly    39 LEDPGKALVVESMKDVKHKLLILSGKGGVGKSTVTSLLTRYLARSNPDSNFGVLDIDICGPSQPR 103
            :|:....:...|:..:||.:||||||||||||:||:...  |...:.....||||||:.|||.||
Yeast     1 MEEQEIGVPAASLAGIKHIILILSGKGGVGKSSVTTQTA--LTLCSMGFKVGVLDIDLTGPSLPR 63

  Fly   104 LMGALGESVHQSGYGWSPVGIEDN----VCLMSIGFLLGSVDDAIIWRGPKKNGMIRQFLSEVDW 164
            :.|...||::|...||.||.:|.|    :.::|:|||||...:::|||||||..||:||:|:|.|
Yeast    64 MFGLENESIYQGPEGWQPVKVETNSTGSLSVISLGFLLGDRGNSVIWRGPKKTSMIKQFISDVAW 128

  Fly   165 GNLDLLLLDTPPGTSDEHLSV---VSYLKDDANPESLRAVMVTTPQEVSLLDVRKEINFCKKQNI 226
            |.||.||:||||||||||:|:   :.|.|.|.      .::|||||.|:..||:||||||||.::
Yeast   129 GELDYLLIDTPPGTSDEHISIAEELRYSKPDG------GIVVTTPQSVATADVKKEINFCKKVDL 187

  Fly   227 PIVGVIENMSSFRCGHCGNSSEIFPAKTGGAAAMCAEMGIPLLGSLPLD----QQISKACDSGED 287
            .|:|:|||||.|.|.||...:.||  .:||...:..:..:|.||::|:|    :.|.....|.:.
Yeast   188 KILGIIENMSGFVCPHCAECTNIF--SSGGGKRLSEQFSVPYLGNVPIDPKFVEMIENQVSSKKT 250

  Fly   288 LTE 290
            |.|
Yeast   251 LVE 253

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17904NP_609805.1 Mrp 10..282 CDD:223563 116/254 (46%)
ParA 54..307 CDD:287566 117/249 (47%)
CFD1NP_012263.1 ParA 16..271 CDD:313763 117/249 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001173
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126620
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.800

Return to query results.
Submit another query.