DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17904 and NBP35

Sequence 1:NP_609805.1 Gene:CG17904 FlyBaseID:FBgn0032597 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_568748.1 Gene:NBP35 AraportID:AT5G50960 Length:350 Species:Arabidopsis thaliana

Alignment Length:341 Identity:157/342 (46%)
Similarity:215/342 (63%) Gaps:45/342 (13%)


  Fly     7 EHCPGVESEEAGKGSACSGCPNQGLCSDPNKKLEDPGKALVVESMKDVKHKLLILSGKGGVGKST 71
            |||||.:||.|||..:|:|||||..|:...|. .||....:.|.|..||||:|:|||||||||||
plant    12 EHCPGPQSESAGKSDSCAGCPNQEACATAPKG-PDPDLVAIAERMSTVKHKILVLSGKGGVGKST 75

  Fly    72 VTSLLTRYLARSNPDSNFGVLDIDICGPSQPRLMGALGESVHQSGYGWSPVGIEDNVCLMSIGFL 136
            .::.|:  .|.:..|...|::||||||||.|:::|..|:.:|||..|||||.:|||:.:|||||:
plant    76 FSAQLS--FALAGMDHQVGLMDIDICGPSIPKMLGLEGQEIHQSNLGWSPVYVEDNLGVMSIGFM 138

  Fly   137 LGSVDDAIIWRGPKKNGMIRQFLSEVDWGNLDLLLLDTPPGTSDEHLSVVSYLKDDANPESL-RA 200
            |.:.|:|:|||||:|||:|:|||.:|.||.:|.|::|.||||||||:|:|.||.    |..: .|
plant   139 LPNSDEAVIWRGPRKNGLIKQFLKDVYWGEIDYLVVDAPPGTSDEHISIVQYLL----PTGIDGA 199

  Fly   201 VMVTTPQEVSLLDVRKEINFCKKQNIPIVGVIENMSSFR-----------CGHCGNS-------- 246
            ::|||||||||:|||||::||||..:|::||:||||...           ....|:|        
plant   200 IIVTTPQEVSLIDVRKEVSFCKKVGVPVLGVVENMSGLSQPLKDVKFMKLATETGSSINVTEDVI 264

  Fly   247 ----------------SEIFPAKTGGAAAMCAEMGIPLLGSLPLDQQISKACDSGEDLTEFKN-- 293
                            ||:|.:..|||..||.|||:|.||.:|:|.|:.||.:.|:...|...  
plant   265 ACLRKNAPELLDIVACSEVFDSSGGGAERMCREMGVPFLGKVPMDPQLCKAAEQGKSCFEDNKCL 329

  Fly   294 VTTEALEGICSKIMAS 309
            ::..||:.|..|::.|
plant   330 ISAPALKSIIQKVVPS 345

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17904NP_609805.1 Mrp 10..282 CDD:223563 147/308 (48%)
ParA 54..307 CDD:287566 134/291 (46%)
NBP35NP_568748.1 ParA 58..343 CDD:287566 134/291 (46%)
minD_arch 62..343 CDD:131024 130/287 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H1857
Inparanoid 1 1.050 305 1.000 Inparanoid score I744
OMA 1 1.010
OrthoDB 1 1.010 D1166096at2759
OrthoInspector 1 1.000 T193476
orthoMCL 1 0.900 OOG5_126620
Panther 1 1.100 LDO PTHR23264
Phylome 1 0.910 0.667 Consistency score
98.980

Return to query results.
Submit another query.