DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17904 and nubp1

Sequence 1:NP_609805.1 Gene:CG17904 FlyBaseID:FBgn0032597 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_001017538.1 Gene:nubp1 ZFINID:ZDB-GENE-050417-471 Length:321 Species:Danio rerio

Alignment Length:303 Identity:180/304 (59%)
Similarity:221/304 (73%) Gaps:6/304 (2%)


  Fly     6 PEHCPGVESEEAGKGSACSGCPNQGLCSDPNKKLEDPGKALVVESMKDVKHKLLILSGKGGVGKS 70
            ||||||..|::|||.|||.|||||.:|:....|..||....:.:.|..||||:|:||||||||||
Zfish     9 PEHCPGTSSDQAGKSSACQGCPNQSICASGATKAPDPAIEEIKQKMTSVKHKILVLSGKGGVGKS 73

  Fly    71 TVTSLLTRYLARSNPDSNFGVLDIDICGPSQPRLMGALGESVHQSGYGWSPVGIEDNVCLMSIGF 135
            |.::.|:..|| |:......:||:||||||.|::||..||.|||||.|||||.:|||:.:|||||
Zfish    74 TFSAHLSHALA-SDSSKEVALLDVDICGPSIPKIMGLEGEQVHQSGSGWSPVYVEDNLAVMSIGF 137

  Fly   136 LLGSVDDAIIWRGPKKNGMIRQFLSEVDWGNLDLLLLDTPPGTSDEHLSVVSYLKDDANPESLRA 200
            ||.|.|||:|||||||||||:|||.:||||.:|.|::||||||||||||:|.|| ..|..:.  |
Zfish   138 LLSSPDDAVIWRGPKKNGMIKQFLRDVDWGEVDYLIVDTPPGTSDEHLSIVQYL-SGAGIDG--A 199

  Fly   201 VMVTTPQEVSLLDVRKEINFCKKQNIPIVGVIENMSSFRCGHCGNSSEIFPAKTGGAAAMCAEMG 265
            |::||||||||.||||||.||||.|:||:|||||||.|.|..|.|:|:|||..||||..||.|:.
Zfish   200 VIITTPQEVSLQDVRKEIRFCKKVNLPILGVIENMSGFVCPKCKNTSQIFPPTTGGAQRMCEELN 264

  Fly   266 IPLLGSLPLDQQISKACDSGED-LTEF-KNVTTEALEGICSKI 306
            :||||.:|||.:|.|:||.|:. |||. .:....|.:.|..||
Zfish   265 LPLLGRIPLDPRIGKSCDEGKSFLTEVPDSPAAAAYQSIVQKI 307

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17904NP_609805.1 Mrp 10..282 CDD:223563 166/272 (61%)
ParA 54..307 CDD:287566 157/256 (61%)
nubp1NP_001017538.1 ParA 56..307 CDD:287566 156/255 (61%)
FlhG 59..317 CDD:223531 155/254 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C40221972
eggNOG 1 0.900 E1_COG0489
Hieranoid 1 1.000
Homologene 1 1.000 H1857
Inparanoid 1 1.050 362 1.000 Inparanoid score I2117
OMA 1 1.010
OrthoDB 1 1.010 D1166096at2759
OrthoFinder 1 1.000 FOG0001173
OrthoInspector 1 1.000 T1053553
orthoMCL 1 0.900 OOG5_126620
Panther 1 1.100 LDO PTHR23264
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R796
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.