DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17904 and SPAC637.08

Sequence 1:NP_609805.1 Gene:CG17904 FlyBaseID:FBgn0032597 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_594626.1 Gene:SPAC637.08 PomBaseID:SPAC637.08 Length:317 Species:Schizosaccharomyces pombe

Alignment Length:302 Identity:164/303 (54%)
Similarity:210/303 (69%) Gaps:11/303 (4%)


  Fly     6 PEHCPGVESEEAGKGSACSGCPNQGLCSDPNKKLEDPGKALVVESMKDVKHKLLILSGKGGVGKS 70
            ||||||..||.||..|||.|||||.:|:...:. |||...||||.:|::|||:|:||||||||||
pombe    12 PEHCPGPSSENAGTASACEGCPNQQICASAPRG-EDPDLPLVVERLKEIKHKILVLSGKGGVGKS 75

  Fly    71 TVTSLLTRYLARSNPDSNFGVLDIDICGPSQPRLMGALGESVHQSGYGWSPVGIEDNVCLMSIGF 135
            |.:|.|...|:... |...|::|:||||||.||:||...|..|||..||||:.:..|:.:|||||
pombe    76 TFSSQLAWGLSLEE-DKQIGLMDVDICGPSIPRIMGVEKEEAHQSSKGWSPIYVCPNLAVMSIGF 139

  Fly   136 LLGSVDDAIIWRGPKKNGMIRQFLSEVDWGNLDLLLLDTPPGTSDEHLSVVSYLKDDANPESLRA 200
            ||.|.|.::|||||||||:|:||:.:|:|.|||.|::||||||||||||:|.:.|   |.....|
pombe   140 LLPSEDSSVIWRGPKKNGLIKQFIKDVNWENLDYLIVDTPPGTSDEHLSLVQFFK---NSGIDGA 201

  Fly   201 VMVTTPQEVSLLDVRKEINFCKKQNIPIVGVIENMSSFRCGHCGNSSEIFPAKTGGAAAMCAEMG 265
            |:|||||||:|.||||||:||:|.:|||:|::||||.|.|..|...|.||...|||..|:..|||
pombe   202 VVVTTPQEVALQDVRKEIDFCRKASIPILGLVENMSGFVCPSCKGKSNIFTITTGGGEALAKEMG 266

  Fly   266 IPLLGSLPLDQQISKACDSGEDLTEFKNVTTEALEGICSKIM 307
            :|.||.:|||..|:::||.|      |:...|..|...|:|:
pombe   267 LPFLGKIPLDPLIARSCDFG------KSFIDECPESPASEII 302

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17904NP_609805.1 Mrp 10..282 CDD:223563 152/272 (56%)
ParA 54..307 CDD:287566 137/253 (54%)
SPAC637.08NP_594626.1 Mrp 16..283 CDD:223563 152/272 (56%)
ParA 59..300 CDD:287566 136/251 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H1857
Inparanoid 1 1.050 328 1.000 Inparanoid score I519
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001173
OrthoInspector 1 1.000 T1125363
orthoMCL 1 0.900 OOG5_126620
Panther 1 1.100 LDO PTHR23264
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R796
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.