DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17904 and nubp2

DIOPT Version :9

Sequence 1:NP_609805.1 Gene:CG17904 / 35000 FlyBaseID:FBgn0032597 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_012825448.1 Gene:nubp2 / 100125178 XenbaseID:XB-GENE-999229 Length:270 Species:Xenopus tropicalis


Alignment Length:279 Identity:126/279 - (45%)
Similarity:183/279 - (65%) Gaps:19/279 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KKLEDPGKALVVESMKDVKHKLLILSGKGGVGKSTVTSLLTRYLARSNPDSNFGVLDIDICGPSQ 101
            ::.:|.|      ::..|:|.:|:|||||||||||:::.:.  ||..:.....|:||:|:||||.
 Frog     2 ERSQDGG------NLSGVQHIILVLSGKGGVGKSTISTEIA--LALRHAGKKVGILDVDLCGPSI 58

  Fly   102 PRLMGALGESVHQSGYGWSPVGI--EDNVCLMSIGFLLGSVDDAIIWRGPKKNGMIRQFLSEVDW 164
            ||::.|..:.|||...||.||.:  |.::.||||||||...|||::|||||||.:|:||.|:|.|
 Frog    59 PRMLNAQSKDVHQCDSGWVPVYVDQEKSISLMSIGFLLEHPDDAVVWRGPKKNALIKQFASDVAW 123

  Fly   165 GNLDLLLLDTPPGTSDEHLSVVSYLKDDANPESLRAVMVTTPQEVSLLDVRKEINFCKKQNIPIV 229
            |:||.|::||||||||||::.|..|: ..||  :.|::|||||.||:.|||:|:.||||..:.::
 Frog   124 GDLDFLIVDTPPGTSDEHIATVDALR-PFNP--MGALLVTTPQAVSVGDVRRELTFCKKTGLRVI 185

  Fly   230 GVIENMSSFRCGHCGNSSEIFPAKTGGAAAMCAEMGIPLLGSLPLDQQISKACDSGED-LTEFKN 293
            |::||||.:.|.||...:.||  ..||...:....|:|.||.:|||..:|::.:.|:| :.||.|
 Frog   186 GIVENMSGYVCPHCTECTNIF--SKGGGEELARLSGVPFLGCVPLDPLLSQSLEQGKDFVQEFPN 248

  Fly   294 -VTTEALEGICSKI--MAS 309
             ....|:..|..:|  |||
 Frog   249 SAAYPAISSIARQILDMAS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17904NP_609805.1 Mrp 10..282 CDD:223563 115/246 (47%)
ParA 54..307 CDD:287566 121/258 (47%)
nubp2XP_012825448.1 ParA 12..263 CDD:378455 120/257 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53899
OrthoDB 1 1.010 - - D1166096at2759
OrthoFinder 1 1.000 - - FOG0001227
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.