DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-c-p and CYTC-2

DIOPT Version :10

Sequence 1:NP_477176.1 Gene:Cyt-c-p / 34996 FlyBaseID:FBgn0284248 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_192742.1 Gene:CYTC-2 / 826595 AraportID:AT4G10040 Length:112 Species:Arabidopsis thaliana


Alignment Length:104 Identity:62/104 - (59%)
Similarity:79/104 - (75%) Gaps:0/104 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PAGDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAAGFAYTDANKAKGITWNEDT 68
            |.|:.:.|:|:|..:||||||||.|..||.||||:||.||::|...|::|:.|||:..:.|.|.|
plant     8 PPGNPKAGEKIFRTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKSMAVNWEEKT 72

  Fly    69 LFEYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKSAT 107
            |::||.|||||||||||:|.|||||.:|.|||||||..|
plant    73 LYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKEGT 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-c-pNP_477176.1 Cyc7 6..105 CDD:442697 59/98 (60%)
CYTC-2NP_192742.1 Cyc7 10..109 CDD:442697 59/98 (60%)

Return to query results.
Submit another query.