DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-c-p and Cyt-c-d

DIOPT Version :10

Sequence 1:NP_477176.1 Gene:Cyt-c-p / 34996 FlyBaseID:FBgn0284248 Length:108 Species:Drosophila melanogaster
Sequence 2:NP_477164.1 Gene:Cyt-c-d / 34995 FlyBaseID:FBgn0086907 Length:105 Species:Drosophila melanogaster


Alignment Length:105 Identity:75/105 - (71%)
Similarity:86/105 - (81%) Gaps:2/105 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGVPAGDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAAGFAYTDANKAKGITWN 65
            ||  :||.|.|||:|||:||||||.|.||||||||||.|::|||.|.|||:.|||||..||:||.
  Fly     1 MG--SGDAENGKKIFVQKCAQCHTYEVGGKHKVGPNLGGVVGRKCGTAAGYKYTDANIKKGVTWT 63

  Fly    66 EDTLFEYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKS 105
            |..|.|||::||||||||||:||||||..||.||||:|||
  Fly    64 EGNLDEYLKDPKKYIPGTKMVFAGLKKAEERADLIAFLKS 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-c-pNP_477176.1 Cyc7 6..105 CDD:442697 71/98 (72%)
Cyt-c-dNP_477164.1 Cyc7 4..103 CDD:442697 71/98 (72%)

Return to query results.
Submit another query.