DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyt-c-d and CYC1

Sequence 1:NP_001260509.1 Gene:Cyt-c-d FlyBaseID:FBgn0086907 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_012582.1 Gene:CYC1 SGDID:S000003809 Length:109 Species:Saccharomyces cerevisiae

Alignment Length:100 Identity:62/100 (62%)
Similarity:72/100 (72%) Gaps:0/100 (0%)


  Fly     3 SGDAENGKKIFVQKCAQCHTYEVGGKHKVGPNLGGVVGRKCGTAAGYKYTDANIKKGVTWTEGNL 67
            :|.|:.|..:|..:|.||||.|.||.|||||||.|:.||..|.|.||.||||||||.|.|.|.|:
Yeast     6 AGSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEGYSYTDANIKKNVLWDENNM 70

  Fly    68 DEYLKDPKKYIPGTKMVFAGLKKAEERADLIAFLK 102
            .|||.:||||||||||.|.||||.::|.|||.:||
Yeast    71 SEYLTNPKKYIPGTKMAFGGLKKEKDRNDLITYLK 105

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyt-c-dNP_001260509.1 Cyc7 <4..103 CDD:226005 62/99 (63%)
CxxCH_TIGR02603 4..103 CDD:274224 62/99 (63%)
CYC1NP_012582.1 Cyc7 1..109 CDD:226005 62/100 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130779441
eggNOG 1 0.900 E1_COG3474
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 146 1.000 Inparanoid score I1130
Isobase 1 0.950 0 Normalized mean entropy S155
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001344
OrthoInspector 1 1.000 T133807
orthoMCL 1 0.900 OOG5_127365
Panther 1 1.100 O PTHR11961
Phylome 1 0.910 0.600 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
1211.710

Return to query results.
Submit another query.