DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyt-c-d and CYTC-2

Sequence 1:NP_001260509.1 Gene:Cyt-c-d FlyBaseID:FBgn0086907 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_192742.1 Gene:CYTC-2 AraportID:AT4G10040 Length:112 Species:Arabidopsis thaliana

Alignment Length:99 Identity:60/100 (60%)
Similarity:71/100 (71%) Gaps:0/100 (0%)


  Fly     4 GDAENGKKIFVQKCAQCHTYEVGGKHKVGPNLGGVVGRKCGTAAGYKYTDANIKKGVTWTEGNLD 68
            |:.:.|:|||..|||||||.|.|..||.||||.|:.||:.||..||.|:.||....|.|.|..|.
plant    10 GNPKAGEKIFRTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKSMAVNWEEKTLY 74

  Fly    69 EYLKDPKKYIPGTKMVFAGLKKAEERADLIAFLK 102
            :||.:||||||||||||.||||.::||||||:||
plant    75 DYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLK 108

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyt-c-dNP_001260509.1 Cyc7 <4..103 CDD:226005 60/100 (60%)
CxxCH_TIGR02603 4..103 CDD:274224 60/100 (60%)
CYTC-2NP_192742.1 Cytochrom_C 8..111 CDD:328733 60/100 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 146 1.000 Inparanoid score I1696
OMA 1 1.010
OrthoDB 1 1.010 D1533604at2759
OrthoInspector 1 1.000 T32295
orthoMCL 1 0.900 OOG5_127365
Panther 1 1.100 O PTHR11961
Phylome 1 0.910 0.600 Consistency score
87.980

Return to query results.
Submit another query.