DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyt-c-d and cycs

Sequence 1:NP_001260509.1 Gene:Cyt-c-d FlyBaseID:FBgn0086907 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_988895.1 Gene:cycs XenbaseID:XB-GENE-971588 Length:105 Species:Xenopus tropicalis

Alignment Length:101 Identity:71/102 (70%)
Similarity:81/102 (79%) Gaps:0/102 (0%)


  Fly     4 GDAENGKKIFVQKCAQCHTYEVGGKHKVGPNLGGVVGRKCGTAAGYKYTDANIKKGVTWTEGNLD 68
            ||||.|||||||||:||||.|.|||||.||||.|:.|||.|.|.|:.|||||..||:.|.||.|.
 Frog     2 GDAEKGKKIFVQKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAEGFSYTDANKNKGIVWDEGTLL 66

  Fly    69 EYLKDPKKYIPGTKMVFAGLKKAEERADLIAFLKSN 104
            |||::||||||||||:|||:||..||.||||:||.:
 Frog    67 EYLENPKKYIPGTKMIFAGIKKKGERQDLIAYLKQS 102

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyt-c-dNP_001260509.1 Cyc7 <4..103 CDD:226005 71/99 (72%)
CxxCH_TIGR02603 4..103 CDD:274224 71/99 (72%)
cycsNP_988895.1 Cyc7 1..105 CDD:226005 71/102 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG3474
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1533604at2759
OrthoFinder 1 1.000 FOG0001344
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.870

Return to query results.
Submit another query.