DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cyt-c-d and Pde11a

Sequence 1:NP_001260509.1 Gene:Cyt-c-d FlyBaseID:FBgn0086907 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_543169.1 Gene:Pde11a RGDID:621793 Length:935 Species:Rattus norvegicus

Alignment Length:145 Identity:33/146 (23%)
Similarity:44/146 (30%) Gaps:59/146 (40%)


  Fly     6 AENGKKIFVQK---------CAQCHTYEVGGKHKV--GPNLGGVVGRKCGTA------------- 46
            |..|||..|.|         ...|.|.|...:.:|  |..:.|.||....|.             
  Rat   246 AAAGKKTLVSKFFDVHAGTPLLPCSTTENSNEVQVPWGKGIIGYVGEHGETVNIPDAYQDRRFND 310

  Fly    47 -----AGYK----------YTDANI----------KKGVTWTEGNLDEYLKDPKKYIP------G 80
                 .|||          .:|..|          .:|..:||.  ||  |..:.|:|      .
  Rat   311 EIDKLTGYKTKSLLCMPIRNSDGEIIGVAQAINKVPEGAPFTED--DE--KVMQMYLPFCGIAIS 371

  Fly    81 TKMVFAGLKKAEERA 95
            ...:||..:|..||:
  Rat   372 NAQLFAASRKEYERS 386

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cyt-c-dNP_001260509.1 Cyc7 <4..103 CDD:226005 33/146 (23%)
CxxCH_TIGR02603 4..103 CDD:274224 33/146 (23%)
Pde11aNP_543169.1 GAF 217..380 CDD:214500 30/138 (22%)
GAF 402..568 CDD:214500
PDEase_I 663..898 CDD:278654
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.