DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyt-c-d and Pde11a

DIOPT Version :10

Sequence 1:NP_477164.1 Gene:Cyt-c-d / 34995 FlyBaseID:FBgn0086907 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_543169.1 Gene:Pde11a / 140928 RGDID:621793 Length:935 Species:Rattus norvegicus


Alignment Length:145 Identity:33/145 - (22%)
Similarity:44/145 - (30%) Gaps:59/145 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AENGKKIFVQK---------CAQCHTYEVGGKHKV--GPNLGGVVGRKCGTA------------- 46
            |..|||..|.|         ...|.|.|...:.:|  |..:.|.||....|.             
  Rat   246 AAAGKKTLVSKFFDVHAGTPLLPCSTTENSNEVQVPWGKGIIGYVGEHGETVNIPDAYQDRRFND 310

  Fly    47 -----AGYK----------YTDANI----------KKGVTWTEGNLDEYLKDPKKYIP------G 80
                 .|||          .:|..|          .:|..:||.  ||  |..:.|:|      .
  Rat   311 EIDKLTGYKTKSLLCMPIRNSDGEIIGVAQAINKVPEGAPFTED--DE--KVMQMYLPFCGIAIS 371

  Fly    81 TKMVFAGLKKAEERA 95
            ...:||..:|..||:
  Rat   372 NAQLFAASRKEYERS 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyt-c-dNP_477164.1 Cyc7 4..103 CDD:442697 33/145 (23%)
Pde11aNP_543169.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..125
GAF 217..380 CDD:214500 30/137 (22%)
GAF 402..568 CDD:214500
PDEase_I 663..898 CDD:459723
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 915..935
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.