DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment her and Zfp341

DIOPT Version :8

Sequence 1:NP_001260506.1 Gene:her / 34992 FlyBaseID:FBgn0001185 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_955008.2 Gene:Zfp341 / 228807 MGIID:2682937 Length:846 Species:Mus musculus

Alignment Length:258 Identity:62/259 (24%)
Similarity:102/259 (39%) Gaps:67/259 (26%)


  Fly    17 SAWKFRCSVDRCPYRTNRPYNLARHEESHIGITQSKLYGCPVCVYNTDKASNLKRHVSIKHPGCK 81
            |..:|||.:  |.....:.:.|..|...|.|   .|.|.|.||....::...||||:.|..|..|
Mouse   587 SGGRFRCQI--CKKFFRKEHYLKLHAHIHSG---EKPYKCSVCESAFNRKDKLKRHMLIHEPFKK 646

  Fly    82 KRPPEAQHKDRNAKLQCLVMGCRYETNRPYDLKRHLMVHNNPEKSHRTFKCSLCTYSSDRKANLK 146
            .:.|.:.|           .||..|.||...||.|::.|.. .|.|   ||.||:.|..|:|:|.
Mouse   647 YKCPFSMH-----------TGCSKEFNRQDKLKAHILSHAG-LKLH---KCGLCSKSFSRRAHLA 696

  Fly   147 RH-------HELRHSGIEEAIQTAEELRQEMLLEKQMLKEHKLKYQITEKQDLKNLKLKDQKQKV 204
            .|       ::.|.:|..:...           ..:.||:|:.:...|:.:||:           
Mouse   697 EHQRAHTGNYKFRCAGCAKGFS-----------RHKYLKDHRCRLGPTKDKDLQ----------- 739

  Fly   205 QMLRDQQPKQR------------QKKEQLLEDQSPVLNKQLEHGNIPLKEALVGSMKYDEESL 255
               ..:.|::|            .|:|..:.|  |:..::|:... |..||..|...::::::
Mouse   740 ---ARRPPRRRATARGGGSIASGHKEENPMPD--PLGLEELKAAG-PSPEAAPGKPPFEQDAV 796

Known Domains:


GeneSequenceDomainRegion External IDIdentity
herNP_001260506.1 C2H2 Zn finger 23..45 CDD:275368 4/22 (18%)
C2H2 Zn finger 56..77 CDD:275368 8/21 (38%)
C2H2 Zn finger 98..120 CDD:275368 8/22 (36%)
C2H2 Zn finger 132..149 CDD:275370 8/24 (33%)
tolA 140..>220 CDD:236545 16/99 (16%)
Zfp341NP_955008.2 COG5048 321..726 CDD:227381 47/170 (28%)
zf-C2H2 321..342 CDD:278523
C2H2 Zn finger 322..342 CDD:275368
zf-H2C2_2 334..359 CDD:290200
C2H2 Zn finger 350..370 CDD:275368
C2H2 Zn finger 444..464 CDD:275368
C2H2 Zn finger 472..494 CDD:275368
C2H2 Zn finger 502..522 CDD:275368
C2H2 Zn finger 539..561 CDD:275370
C2H2 Zn finger 565..585 CDD:275368
C2H2 Zn finger 593..613 CDD:275368 4/22 (18%)
zf-H2C2_2 605..630 CDD:290200 9/28 (32%)
C2H2 Zn finger 621..641 CDD:275368 8/20 (40%)
C2H2 Zn finger 649..674 CDD:275368 10/36 (28%)
C2H2 Zn finger 682..702 CDD:275368 8/20 (40%)
C2H2 Zn finger 710..727 CDD:275368 4/28 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.