DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5888 and lrrc38a

DIOPT Version :9

Sequence 1:NP_001285981.1 Gene:CG5888 / 34980 FlyBaseID:FBgn0028523 Length:455 Species:Drosophila melanogaster
Sequence 2:XP_021325623.1 Gene:lrrc38a / 567935 ZFINID:ZDB-GENE-080327-12 Length:290 Species:Danio rerio


Alignment Length:112 Identity:26/112 - (23%)
Similarity:56/112 - (50%) Gaps:4/112 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 VPTELFWMSEQLAYIGIRSN-ISYLSKDFLKVQKKLLTLRLERNNIARLPDQLFRNTPLILEIHL 319
            :|::...:...|.|:.:|:| ::.|....|....:|:.|.|..||:..:|...|..:..::::.|
Zfish    69 IPSDFLVLYSDLVYLDLRNNSLTRLEPGTLSTSSRLVYLDLGSNNLTEIPSGTFGESRSLIKLRL 133

  Fly   320 AFNN--LDRIQSGLFDKLKNLQVLNLEHNPITTIALNAFTPIPTAHI 364
            . ||  |:.:....|..|.:|:.|.||.|.::.:.:...:.:|:..:
Zfish   134 G-NNPYLNMVSKDAFLGLTSLRELELESNALSGLDVEVLSQLPSLRV 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5888NP_001285981.1 leucine-rich repeat 168..189 CDD:275380
leucine-rich repeat 190..213 CDD:275380
leucine-rich repeat 214..243 CDD:275380
leucine-rich repeat 244..266 CDD:275380 1/9 (11%)
leucine-rich repeat 267..289 CDD:275380 6/22 (27%)
LRR_8 288..348 CDD:290566 18/61 (30%)
leucine-rich repeat 290..313 CDD:275380 7/22 (32%)
leucine-rich repeat 314..337 CDD:275380 6/24 (25%)
leucine-rich repeat 338..357 CDD:275380 5/18 (28%)
lrrc38aXP_021325623.1 LRRNT 26..56 CDD:214470
leucine-rich repeat 36..58 CDD:275380
leucine-rich repeat 59..79 CDD:275380 1/9 (11%)
PLN00113 <60..>185 CDD:331614 26/112 (23%)
leucine-rich repeat 80..103 CDD:275380 6/22 (27%)
LRR_8 102..163 CDD:316378 18/61 (30%)
leucine-rich repeat 104..127 CDD:275380 7/22 (32%)
leucine-rich repeat 128..152 CDD:275380 6/24 (25%)
leucine-rich repeat 153..176 CDD:275380 5/22 (23%)
TPKR_C2 185..>219 CDD:326558
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46473
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.