DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5888 and LRRC52

DIOPT Version :9

Sequence 1:NP_001285981.1 Gene:CG5888 / 34980 FlyBaseID:FBgn0028523 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001005214.2 Gene:LRRC52 / 440699 HGNCID:32156 Length:313 Species:Homo sapiens


Alignment Length:421 Identity:80/421 - (19%)
Similarity:146/421 - (34%) Gaps:143/421 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KEPNLCECQEQEIKCENLQLHSDNLQLYGISCSIFDARGF------GYIPPLKVGNIGSLIVQNC 95
            |.||.|.||.||:.|...||..     |.:...:...|.|      ..:|.:.:|.:..|:..:|
Human    25 KCPNNCLCQAQEVICTGKQLTE-----YPLDIPLNTRRLFLNENRITSLPAMHLGLLSDLVYLDC 84

  Fly    96 AIPNAESIKYLLSKLGVSNYTELEIFNYFDPKKTDRGEVLQQHYTDHESLKKVSIIGFKSTLPEN 160
            .......         |.:||.:.:|...              |.|..|....||..|..::..|
Human    85 QNNRIRE---------VMDYTFIGVFKLI--------------YLDLSSNNLTSISPFTFSVLSN 126

  Fly   161 FLENLPALQQLSLKGSSDLPGNILHPLKNLTHLEIVVKNLGKVSGAIFAKQSKLKHLMIDCDAKN 225
                   |.||:              :.|..||    .:|.|.:   ||..:.|::|    |.:|
Human   127 -------LVQLN--------------IANNPHL----LSLHKFT---FANTTSLRYL----DLRN 159

  Fly   226 SSVEMSAFGPQELWHMTELQSIELFNCGDNVPTELFWMSEQLAYIGIRSNISYLSKDFLKVQKKL 290
            :.::  ......|:|:|.|::  ||..|:.      |          :.|.|:|  ||...   |
Human   160 TGLQ--TLDSAALYHLTTLET--LFLSGNP------W----------KCNCSFL--DFAIF---L 199

  Fly   291 LTLRLERNNIARLPDQLFRNTPLILEIHLAFNNLDRIQSGLFDKLKNLQVLNLEHNPITTIALNA 355
            :...::.:      |.|  |...:....|....:.|:.    :.|:.:.:.:|:|.....:.|..
Human   200 IVFHMDPS------DDL--NATCVEPTELTGWPITRVG----NPLRYMCITHLDHKDYIFLLLIG 252

  Fly   356 FTPIPTAHIYVGKLFKAAKNADWARSTNATICEEEYIYGVC--IYCKRDEYLDHFADSENCNKPN 418
            |.           :|.|...|.|             :.|||  :|    :...|.:..|:.::..
Human   253 FC-----------IFAAGTVAAW-------------LTGVCAVLY----QNTRHKSSEEDEDEAG 289

  Fly   419 PKAKDVLAKKAYENQLKAMPTHSWKKAKEYP 449
            .:.:  ::::.::.|..::        :|:|
Human   290 TRVE--VSRRIFQTQTSSV--------QEFP 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5888NP_001285981.1 leucine-rich repeat 168..189 CDD:275380 3/20 (15%)
leucine-rich repeat 190..213 CDD:275380 6/22 (27%)
leucine-rich repeat 214..243 CDD:275380 6/28 (21%)
leucine-rich repeat 244..266 CDD:275380 5/21 (24%)
leucine-rich repeat 267..289 CDD:275380 5/21 (24%)
LRR_8 288..348 CDD:290566 9/59 (15%)
leucine-rich repeat 290..313 CDD:275380 4/22 (18%)
leucine-rich repeat 314..337 CDD:275380 3/22 (14%)
leucine-rich repeat 338..357 CDD:275380 3/18 (17%)
LRRC52NP_001005214.2 PRK15387 <2..>93 CDD:185285 18/81 (22%)
LRRNT 26..55 CDD:214470 11/33 (33%)
leucine-rich repeat 35..54 CDD:275380 6/23 (26%)
LRR 1 54..75 3/20 (15%)
leucine-rich repeat 55..78 CDD:275380 4/22 (18%)
LRR 2 78..99 5/29 (17%)
LRR_8 79..136 CDD:338972 17/100 (17%)
leucine-rich repeat 79..102 CDD:275380 5/31 (16%)
LRR 3 102..123 6/34 (18%)
leucine-rich repeat 103..126 CDD:275380 6/36 (17%)
LRR_8 126..185 CDD:338972 22/94 (23%)
LRR 4 126..148 10/49 (20%)
leucine-rich repeat 127..151 CDD:275380 10/44 (23%)
LRR 5 151..172 5/26 (19%)
leucine-rich repeat 152..175 CDD:275380 6/28 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR46473
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.