| Sequence 1: | NP_001285981.1 | Gene: | CG5888 / 34980 | FlyBaseID: | FBgn0028523 | Length: | 455 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001005214.2 | Gene: | LRRC52 / 440699 | HGNCID: | 32156 | Length: | 313 | Species: | Homo sapiens |
| Alignment Length: | 421 | Identity: | 80/421 - (19%) |
|---|---|---|---|
| Similarity: | 146/421 - (34%) | Gaps: | 143/421 - (33%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 37 KEPNLCECQEQEIKCENLQLHSDNLQLYGISCSIFDARGF------GYIPPLKVGNIGSLIVQNC 95
Fly 96 AIPNAESIKYLLSKLGVSNYTELEIFNYFDPKKTDRGEVLQQHYTDHESLKKVSIIGFKSTLPEN 160
Fly 161 FLENLPALQQLSLKGSSDLPGNILHPLKNLTHLEIVVKNLGKVSGAIFAKQSKLKHLMIDCDAKN 225
Fly 226 SSVEMSAFGPQELWHMTELQSIELFNCGDNVPTELFWMSEQLAYIGIRSNISYLSKDFLKVQKKL 290
Fly 291 LTLRLERNNIARLPDQLFRNTPLILEIHLAFNNLDRIQSGLFDKLKNLQVLNLEHNPITTIALNA 355
Fly 356 FTPIPTAHIYVGKLFKAAKNADWARSTNATICEEEYIYGVC--IYCKRDEYLDHFADSENCNKPN 418
Fly 419 PKAKDVLAKKAYENQLKAMPTHSWKKAKEYP 449 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG5888 | NP_001285981.1 | leucine-rich repeat | 168..189 | CDD:275380 | 3/20 (15%) |
| leucine-rich repeat | 190..213 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 214..243 | CDD:275380 | 6/28 (21%) | ||
| leucine-rich repeat | 244..266 | CDD:275380 | 5/21 (24%) | ||
| leucine-rich repeat | 267..289 | CDD:275380 | 5/21 (24%) | ||
| LRR_8 | 288..348 | CDD:290566 | 9/59 (15%) | ||
| leucine-rich repeat | 290..313 | CDD:275380 | 4/22 (18%) | ||
| leucine-rich repeat | 314..337 | CDD:275380 | 3/22 (14%) | ||
| leucine-rich repeat | 338..357 | CDD:275380 | 3/18 (17%) | ||
| LRRC52 | NP_001005214.2 | PRK15387 | <2..>93 | CDD:185285 | 18/81 (22%) |
| LRRNT | 26..55 | CDD:214470 | 11/33 (33%) | ||
| leucine-rich repeat | 35..54 | CDD:275380 | 6/23 (26%) | ||
| LRR 1 | 54..75 | 3/20 (15%) | |||
| leucine-rich repeat | 55..78 | CDD:275380 | 4/22 (18%) | ||
| LRR 2 | 78..99 | 5/29 (17%) | |||
| LRR_8 | 79..136 | CDD:338972 | 17/100 (17%) | ||
| leucine-rich repeat | 79..102 | CDD:275380 | 5/31 (16%) | ||
| LRR 3 | 102..123 | 6/34 (18%) | |||
| leucine-rich repeat | 103..126 | CDD:275380 | 6/36 (17%) | ||
| LRR_8 | 126..185 | CDD:338972 | 22/94 (23%) | ||
| LRR 4 | 126..148 | 10/49 (20%) | |||
| leucine-rich repeat | 127..151 | CDD:275380 | 10/44 (23%) | ||
| LRR 5 | 151..172 | 5/26 (19%) | |||
| leucine-rich repeat | 152..175 | CDD:275380 | 6/28 (21%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | LDO | PTHR46473 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||