DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5888 and LRRC26

DIOPT Version :8

Sequence 1:NP_001285981.1 Gene:CG5888 / 34980 FlyBaseID:FBgn0028523 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001013675.1 Gene:LRRC26 / 389816 HGNCID:31409 Length:334 Species:Homo sapiens

Alignment Length:137 Identity:35/138 (25%)
Similarity:56/138 (41%) Gaps:8/138 (6%)


  Fly   213 KLKHLMIDCDAKNSSVEMSAFGPQELWHMTELQSIELFNCG-DNVPTELFWMSEQLAYIGIRSN- 275
            :|:.|::|.:      .:.|..|........||.::|...| .:|....||....|..:.:.:| 
Human    72 RLRALLLDHN------RVRALPPGAFAGAGALQRLDLRENGLHSVHVRAFWGLGALQLLDLSANQ 130

  Fly   276 ISYLSKDFLKVQKKLLTLRLERNNIARLPDQLFRNTPLILEIHLAFNNLDRIQSGLFDKLKNLQV 340
            :..|:.......:.|..|.|..|.:|||........||:..:.|..|.|..:..||..:|..|..
Human   131 LEALAPGTFAPLRALRNLSLAGNRLARLEPAALGALPLLRSLSLQDNELAALAPGLLGRLPALDA 195

  Fly   341 LNLEHNP 347
            |:|..||
Human   196 LHLRGNP 202

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5888NP_001285981.1 leucine-rich repeat 168..189 CDD:275380
leucine-rich repeat 190..213 CDD:275380 35/138 (25%)
leucine-rich repeat 214..243 CDD:275380 5/29 (17%)
leucine-rich repeat 244..266 CDD:275380 7/23 (30%)
leucine-rich repeat 267..289 CDD:275380 3/23 (13%)
LRR_8 288..348 CDD:290566 20/61 (33%)
leucine-rich repeat 290..313 CDD:275380 8/23 (35%)
leucine-rich repeat 314..337 CDD:275380 6/23 (26%)
leucine-rich repeat 338..357 CDD:275380 5/11 (45%)
LRRC26NP_001013675.1 LRR 1 72..93 5/27 (19%)
LRR 2 96..117 7/21 (33%)
LRR_RI 97..>253 CDD:238064 30/107 (28%)
LRR_8 97..155 CDD:290566 14/58 (24%)
leucine-rich repeat 97..120 CDD:275380 7/23 (30%)
LRR 3 120..141 3/21 (14%)
leucine-rich repeat 121..144 CDD:275380 3/23 (13%)
LRR_8 143..202 CDD:290566 19/59 (32%)
LRR 4 144..167 7/23 (30%)
leucine-rich repeat 145..168 CDD:275380 8/23 (35%)
LRR 5 168..190 6/22 (27%)
leucine-rich repeat 169..192 CDD:275380 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46473
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.