DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG5888 and Lrrc38

DIOPT Version :9

Sequence 1:	NP_001285981.1	Gene:	CG5888 / 34980	FlyBaseID:	FBgn0028523	Length:	455	Species:	Drosophila melanogaster
Sequence 2:	NP_001101461.1	Gene:	Lrrc38 / 313681	RGDID:	1311416	Length:	298	Species:	Rattus norvegicus

Alignment Length:	106	Identity:	31/106 - (29%)
Similarity:	53/106 - (50%)	Gaps:	1/106 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   256 VPTELFWMSEQLAYIGIRSN-ISYLSKDFLKVQKKLLTLRLERNNIARLPDQLFRNTPLILEIHL 319
            :|.:.|.....|.|:..|:| :..|.:.......||..|.|..||:.:|....||:...::::.|
  Rat    75 IPEDFFIFHGDLVYLDFRNNSLRSLEEGTFSGSAKLAFLDLSYNNLTQLGAGAFRSAGRLVKLSL 139

  Fly   320 AFNNLDRIQSGLFDKLKNLQVLNLEHNPITTIALNAFTPIP 360
            |.|||..:....|:.|::||||.|..|.:.::.:.|...:|
  Rat   140 ANNNLAGVHEAAFESLESLQVLELNGNNLRSLNVAALDALP 180

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG5888	NP_001285981.1	leucine-rich repeat	168..189	CDD:275380
		leucine-rich repeat	190..213	CDD:275380
		leucine-rich repeat	214..243	CDD:275380
		leucine-rich repeat	244..266	CDD:275380	2/9 (22%)
		leucine-rich repeat	267..289	CDD:275380	5/22 (23%)
		LRR_8	288..348	CDD:290566	22/59 (37%)
		leucine-rich repeat	290..313	CDD:275380	8/22 (36%)
		leucine-rich repeat	314..337	CDD:275380	7/22 (32%)
		leucine-rich repeat	338..357	CDD:275380	7/18 (39%)
Lrrc38	NP_001101461.1	LRRNT	31..62	CDD:214470
		leucine-rich repeat	42..64	CDD:275380
		LRR_RI	<49..190	CDD:238064	31/106 (29%)
		LRR_8	62..120	CDD:290566	12/44 (27%)
		leucine-rich repeat	65..85	CDD:275380	2/9 (22%)
		leucine-rich repeat	86..109	CDD:275380	5/22 (23%)
		leucine-rich repeat	110..133	CDD:275380	8/22 (36%)
		LRR_8	133..191	CDD:290566	15/48 (31%)
		leucine-rich repeat	134..157	CDD:275380	7/22 (32%)
		leucine-rich repeat	158..181	CDD:275380	8/23 (35%)
		TPKR_C2	190..244	CDD:301599
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR46473
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.100