DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5888 and Lrrc26

DIOPT Version :10

Sequence 1:NP_609794.1 Gene:CG5888 / 34980 FlyBaseID:FBgn0028523 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001014075.1 Gene:Lrrc26 / 311803 RGDID:1308398 Length:334 Species:Rattus norvegicus


Alignment Length:94 Identity:28/94 - (29%)
Similarity:42/94 - (44%) Gaps:1/94 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 NVPTELFWMSEQLAYIGIRSN-ISYLSKDFLKVQKKLLTLRLERNNIARLPDQLFRNTPLILEIH 318
            :|....||....|..:.:.|| :..||.......:.|..|.|..|.:|.|...:....||:..:.
  Rat   113 SVHARAFWGLGVLQRLDLSSNQLETLSPGTFTPLRALSFLSLAGNRLALLEPSILGPLPLLRVLS 177

  Fly   319 LAFNNLDRIQSGLFDKLKNLQVLNLEHNP 347
            |..|:|..:::||.:.|..|.||.|..||
  Rat   178 LQDNSLSALEAGLLNSLPALDVLRLHGNP 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5888NP_609794.1 LRR <160..>359 CDD:443914 28/94 (30%)
leucine-rich repeat 168..189 CDD:275380
leucine-rich repeat 190..213 CDD:275380
leucine-rich repeat 214..243 CDD:275380
leucine-rich repeat 244..266 CDD:275380 3/10 (30%)
leucine-rich repeat 267..289 CDD:275380 5/22 (23%)
leucine-rich repeat 290..313 CDD:275380 6/22 (27%)
leucine-rich repeat 314..337 CDD:275380 6/22 (27%)
leucine-rich repeat 338..357 CDD:275380 6/10 (60%)
Lrrc26NP_001014075.1 LRR <76..>205 CDD:443914 26/91 (29%)
LRR 1 76..97
leucine-rich repeat 77..100 CDD:275380
LRR 2 100..121 2/7 (29%)
leucine-rich repeat 101..124 CDD:275380 3/10 (30%)
LRR 3 124..145 5/20 (25%)
leucine-rich repeat 125..148 CDD:275380 5/22 (23%)
LRR 4 148..169 6/20 (30%)
leucine-rich repeat 149..172 CDD:275380 6/22 (27%)
LRR 5 172..194 6/21 (29%)
leucine-rich repeat 173..196 CDD:275380 6/22 (27%)
PCC 178..>295 CDD:188093 12/29 (41%)
leucine-rich repeat 197..239 CDD:275380 6/10 (60%)
leucine-rich repeat 240..259 CDD:275380
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 312..334
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.