DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG5888 and Lrrc26

DIOPT Version :9

Sequence 1:	NP_001285981.1	Gene:	CG5888 / 34980	FlyBaseID:	FBgn0028523	Length:	455	Species:	Drosophila melanogaster
Sequence 2:	NP_001014075.1	Gene:	Lrrc26 / 311803	RGDID:	1308398	Length:	334	Species:	Rattus norvegicus

Alignment Length:	94	Identity:	28/94 - (29%)
Similarity:	42/94 - (44%)	Gaps:	1/94 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   255 NVPTELFWMSEQLAYIGIRSN-ISYLSKDFLKVQKKLLTLRLERNNIARLPDQLFRNTPLILEIH 318
            :|....||....|..:.:.|| :..||.......:.|..|.|..|.:|.|...:....||:..:.
  Rat   113 SVHARAFWGLGVLQRLDLSSNQLETLSPGTFTPLRALSFLSLAGNRLALLEPSILGPLPLLRVLS 177

  Fly   319 LAFNNLDRIQSGLFDKLKNLQVLNLEHNP 347
            |..|:|..:::||.:.|..|.||.|..||
  Rat   178 LQDNSLSALEAGLLNSLPALDVLRLHGNP 206

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG5888	NP_001285981.1	leucine-rich repeat	168..189	CDD:275380
		leucine-rich repeat	190..213	CDD:275380
		leucine-rich repeat	214..243	CDD:275380
		leucine-rich repeat	244..266	CDD:275380	3/10 (30%)
		leucine-rich repeat	267..289	CDD:275380	5/22 (23%)
		LRR_8	288..348	CDD:290566	20/60 (33%)
		leucine-rich repeat	290..313	CDD:275380	6/22 (27%)
		leucine-rich repeat	314..337	CDD:275380	6/22 (27%)
		leucine-rich repeat	338..357	CDD:275380	6/10 (60%)
Lrrc26	NP_001014075.1	LRR_8	76..135	CDD:290566	6/21 (29%)
		LRR 1	76..97
		leucine-rich repeat	77..100	CDD:275380
		LRR 2	100..121		2/7 (29%)
		leucine-rich repeat	101..124	CDD:275380	3/10 (30%)
		LRR 3	124..145		5/20 (25%)
		LRR_8	125..183	CDD:290566	15/57 (26%)
		LRR_4	125..164	CDD:289563	11/38 (29%)
		leucine-rich repeat	125..148	CDD:275380	5/22 (23%)
		LRR 4	148..169		6/20 (30%)
		leucine-rich repeat	149..172	CDD:275380	6/22 (27%)
		LRR 5	172..194		6/21 (29%)
		leucine-rich repeat	173..196	CDD:275380	6/22 (27%)
		leucine-rich repeat	197..239	CDD:275380	6/10 (60%)
		TPKR_C2	205..258	CDD:301599	2/2 (100%)
		leucine-rich repeat	240..259	CDD:275380
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	312..334
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR46473
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.100