DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5888 and Lrrc38

DIOPT Version :8

Sequence 1:NP_001285981.1 Gene:CG5888 / 34980 FlyBaseID:FBgn0028523 Length:455 Species:Drosophila melanogaster
Sequence 2:XP_006538918.1 Gene:Lrrc38 / 242735 MGIID:2442845 Length:410 Species:Mus musculus

Alignment Length:143 Identity:37/144 (26%)
Similarity:62/144 (43%) Gaps:24/144 (17%)


  Fly   256 VPTELFWMSEQLAYIGIRSN-ISYLSKDFLKVQKKLLTLRLERNNIARLPDQLFRNTPLILEIHL 319
            :|.:.|.....|.|:..|:| :..|.:.......||..|.|..||:.:|....||:...::::.|
Mouse   215 IPEDFFIFHGDLVYLDFRNNSLRSLEEGTFSGSGKLAFLDLSYNNLTQLGAGAFRSAGRLVKLSL 279

  Fly   320 AFNNLDRIQSGLFDKLKNLQVLNLEHNPITTIALNAFTPIPT-----------------AHIY-- 365
            |.|:|..:....|:.|::||||.|..|.:.::.:.|...:|.                 ||::  
Mouse   280 ANNHLAGVHEAAFESLESLQVLELNDNNLRSLNVAALDALPALRTVRLDGNPWLCDCDFAHLFSW 344

  Fly   366 ----VGKLFKAAK 374
                ..||.||.|
Mouse   345 IQENTSKLPKATK 357

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5888NP_001285981.1 leucine-rich repeat 168..189 CDD:275380
leucine-rich repeat 190..213 CDD:275380
leucine-rich repeat 214..243 CDD:275380
leucine-rich repeat 244..266 CDD:275380 2/10 (20%)
leucine-rich repeat 267..289 CDD:275380 5/23 (22%)
LRR_8 288..348 CDD:290566 21/60 (35%)
leucine-rich repeat 290..313 CDD:275380 8/23 (35%)
leucine-rich repeat 314..337 CDD:275380 6/23 (26%)
leucine-rich repeat 338..357 CDD:275380 7/19 (37%)
Lrrc38XP_006538918.1 LRRNT 171..202 CDD:214470
leucine-rich repeat 182..204 CDD:275380
LRR_RI <189..330 CDD:238064 30/115 (26%)
LRR_8 202..260 CDD:290566 13/45 (29%)
leucine-rich repeat 205..225 CDD:275380 2/10 (20%)
leucine-rich repeat 226..249 CDD:275380 5/23 (22%)
leucine-rich repeat 250..273 CDD:275380 8/23 (35%)
LRR_8 273..331 CDD:290566 14/58 (24%)
leucine-rich repeat 274..297 CDD:275380 6/23 (26%)
leucine-rich repeat 298..321 CDD:275380 8/23 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46473
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.