DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5888 and Lrrc26

DIOPT Version :10

Sequence 1:NP_609794.1 Gene:CG5888 / 34980 FlyBaseID:FBgn0028523 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_666229.1 Gene:Lrrc26 / 227618 MGIID:2385129 Length:331 Species:Mus musculus


Alignment Length:144 Identity:37/144 - (25%)
Similarity:55/144 - (38%) Gaps:21/144 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 NVPTELFWMSEQLAYIGIRSN-ISYLSKDFLKVQKKLLTLRLERNNIARLPDQLFRNTPLILEIH 318
            :|....||....|.::.:.|| :..|........:.|..|.|..|.:|.|...:....||:..:.
Mouse   109 SVHARAFWGLGVLQWLDLSSNQLETLPPGTFAPLRALSFLSLAGNRLALLEPSILGPLPLLRVLS 173

  Fly   319 LAFNNLDRIQSGLFDKLKNLQVLNLEHNPITTIALNAFTPIPTAHIYVGKLFKAAKNADWARSTN 383
            |..|:|..|::||.:.|..|.||.|..||.|...  |..|:.|                |.|...
Mouse   174 LQDNSLSAIEAGLLNNLPALDVLRLHGNPWTCNC--ALRPLCT----------------WLRKHP 220

  Fly   384 ATICEEEYIYGVCI 397
            ....|.|.:  :|:
Mouse   221 RPASETETL--LCV 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5888NP_609794.1 LRR <160..>359 CDD:443914 30/104 (29%)
leucine-rich repeat 168..189 CDD:275380
leucine-rich repeat 190..213 CDD:275380
leucine-rich repeat 214..243 CDD:275380
leucine-rich repeat 244..266 CDD:275380 3/10 (30%)
leucine-rich repeat 267..289 CDD:275380 4/22 (18%)
leucine-rich repeat 290..313 CDD:275380 6/22 (27%)
leucine-rich repeat 314..337 CDD:275380 7/22 (32%)
leucine-rich repeat 338..357 CDD:275380 8/18 (44%)
Lrrc26NP_666229.1 LRR <62..>201 CDD:443914 26/91 (29%)
LRR 1 72..93
leucine-rich repeat 73..96 CDD:275380
LRR 2 96..117 2/7 (29%)
leucine-rich repeat 97..120 CDD:275380 3/10 (30%)
LRR 3 120..141 4/20 (20%)
leucine-rich repeat 121..144 CDD:275380 4/22 (18%)
LRR 4 144..165 6/20 (30%)
leucine-rich repeat 145..168 CDD:275380 6/22 (27%)
LRR 5 168..191 7/22 (32%)
leucine-rich repeat 169..192 CDD:275380 7/22 (32%)
PCC 174..>267 CDD:188093 22/79 (28%)
leucine-rich repeat 236..255 CDD:275380
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 310..331
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.