DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG5888 and Lrrc26

DIOPT Version :9

Sequence 1:	NP_001285981.1	Gene:	CG5888 / 34980	FlyBaseID:	FBgn0028523	Length:	455	Species:	Drosophila melanogaster
Sequence 2:	NP_666229.1	Gene:	Lrrc26 / 227618	MGIID:	2385129	Length:	331	Species:	Mus musculus

Alignment Length:	144	Identity:	37/144 - (25%)
Similarity:	55/144 - (38%)	Gaps:	21/144 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly   255 NVPTELFWMSEQLAYIGIRSN-ISYLSKDFLKVQKKLLTLRLERNNIARLPDQLFRNTPLILEIH 318
            :|....||....|.::.:.|| :..|........:.|..|.|..|.:|.|...:....||:..:.
Mouse   109 SVHARAFWGLGVLQWLDLSSNQLETLPPGTFAPLRALSFLSLAGNRLALLEPSILGPLPLLRVLS 173

  Fly   319 LAFNNLDRIQSGLFDKLKNLQVLNLEHNPITTIALNAFTPIPTAHIYVGKLFKAAKNADWARSTN 383
            |..|:|..|::||.:.|..|.||.|..||.|...  |..|:.|                |.|...
Mouse   174 LQDNSLSAIEAGLLNNLPALDVLRLHGNPWTCNC--ALRPLCT----------------WLRKHP 220

  Fly   384 ATICEEEYIYGVCI 397
            ....|.|.:  :|:
Mouse   221 RPASETETL--LCV 232

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG5888	NP_001285981.1	leucine-rich repeat	168..189	CDD:275380
		leucine-rich repeat	190..213	CDD:275380
		leucine-rich repeat	214..243	CDD:275380
		leucine-rich repeat	244..266	CDD:275380	3/10 (30%)
		leucine-rich repeat	267..289	CDD:275380	4/22 (18%)
		LRR_8	288..348	CDD:290566	20/59 (34%)
		leucine-rich repeat	290..313	CDD:275380	6/22 (27%)
		leucine-rich repeat	314..337	CDD:275380	7/22 (32%)
		leucine-rich repeat	338..357	CDD:275380	8/18 (44%)
Lrrc26	NP_666229.1	LRR_8	72..131	CDD:290566	6/21 (29%)
		LRR 1	72..93
		leucine-rich repeat	73..96	CDD:275380
		LRR 2	96..117		2/7 (29%)
		leucine-rich repeat	97..120	CDD:275380	3/10 (30%)
		LRR	118..141	CDD:197688	4/22 (18%)
		LRR 3	120..141		4/20 (20%)
		LRR_8	121..179	CDD:290566	14/57 (25%)
		leucine-rich repeat	121..144	CDD:275380	4/22 (18%)
		LRR 4	144..165		6/20 (30%)
		leucine-rich repeat	145..168	CDD:275380	6/22 (27%)
		LRR 5	168..191		7/22 (32%)
		LRR_4	169..204	CDD:289563	13/34 (38%)
		leucine-rich repeat	169..192	CDD:275380	7/22 (32%)
		TPKR_C2	201..244	CDD:301599	11/52 (21%)
		leucine-rich repeat	236..255	CDD:275380
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	310..331
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR46473
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.100