DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5888 and lron-12

DIOPT Version :8

Sequence 1:NP_001285981.1 Gene:CG5888 / 34980 FlyBaseID:FBgn0028523 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_499578.2 Gene:lron-12 / 190700 WormBaseID:WBGene00013542 Length:401 Species:Caenorhabditis elegans

Alignment Length:368 Identity:65/369 (18%)
Similarity:132/369 (36%) Gaps:126/369 (34%)


  Fly     1 MWWLLLLLSLIAPSWQENATVINPSYVTKAGCEALVKEPNLCECQE--QEIKCENLQLHSDNLQL 63
            :|.||:|...:..|   ||        .:..|      |..|:|.|  |::.||..|:       
 Worm    17 IWKLLILFHFLKYS---NA--------LRDTC------PMGCQCDEDKQQVTCEGQQV------- 57

  Fly    64 YGISCSIFDARGFGYIPPLKVGNIGSLIVQNCAIPNAESIKYLLSKLGVSNYTELEIFNYFDPKK 128
                .::.|....||         .||:::|.::...|.          :::.::|         
 Worm    58 ----VTLPDRLPSGY---------ESLVIRNSSVRTIEK----------NSFRKME--------- 90

  Fly   129 TDRGEVLQQHYTDHESLKKVSIIGFKSTLPENFLENLPALQQLSLKGSSDLPGNILHPLKNLTHL 193
                :::|..:.::.:|..:..:.||.      |:.:..::..:..|.::|..|....::|...|
 Worm    91 ----KLMQIEFENNPNLGTIEKLAFKG------LKKIRLIKFTTCPGLTELQKNAFSGIQNQMGL 145

  Fly   194 EIVVKN--LGKVSGAIFAKQSKLKHLMIDCDAKNSSVEMSAFGPQELWHMTELQSIELFNCGDNV 256
            :|:.:.  :.::.|..|.....::.|.|      |..|::.             |...|      
 Worm   146 KIIFEKTPIHRIDGHTFRNAQNIRELTI------SGEELAL-------------SRHCF------ 185

  Fly   257 PTELFWMSEQLAYIGIRSNISYLSKDFLKVQKKLLTLRLERNNIARLPDQLFRNTPLILEIHLAF 321
                             :||:.|  |||.|           :.:..:..::|.|:.....:|...
 Worm   186 -----------------ANINQL--DFLTV-----------SGVVLIEPEIFTNSTRFHVVHFKN 220

  Fly   322 NNLDRIQSGLFDKLKNLQVLNLEHNPITTIALNAFTPIPTAHI 364
            :..| |....|..|.:...|.:||:.:.:||.:||:.:.|..:
 Worm   221 SQFD-IPPSTFSTLSHTSHLLIEHSKVPSIAPDAFSGLTTIQV 262

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5888NP_001285981.1 leucine-rich repeat 168..189 CDD:275380 3/21 (14%)
leucine-rich repeat 190..213 CDD:275380 4/25 (16%)
leucine-rich repeat 214..243 CDD:275380 4/29 (14%)
leucine-rich repeat 244..266 CDD:275380 2/22 (9%)
leucine-rich repeat 267..289 CDD:275380 7/22 (32%)
LRR_8 288..348 CDD:290566 10/60 (17%)
leucine-rich repeat 290..313 CDD:275380 2/23 (9%)
leucine-rich repeat 314..337 CDD:275380 5/23 (22%)
leucine-rich repeat 338..357 CDD:275380 7/19 (37%)
lron-12NP_499578.2 leucine-rich repeat 48..70 CDD:275380 7/42 (17%)
LRR_5 69..187 CDD:290045 24/189 (13%)
leucine-rich repeat 71..91 CDD:275380 4/43 (9%)
leucine-rich repeat 92..116 CDD:275380 5/30 (17%)
leucine-rich repeat 117..141 CDD:275380 3/24 (13%)
leucine-rich repeat 142..167 CDD:275380 4/25 (16%)
leucine-rich repeat 168..190 CDD:275380 8/64 (13%)
leucine-rich repeat 191..212 CDD:275380 7/34 (21%)
leucine-rich repeat 213..235 CDD:275380 5/23 (22%)
LRR_8 <224..270 CDD:290566 12/41 (29%)
leucine-rich repeat 236..259 CDD:275380 7/23 (30%)
leucine-rich repeat 260..280 CDD:275380 0/4 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR46473
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.