DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5888 and egg-6

DIOPT Version :8

Sequence 1:NP_001285981.1 Gene:CG5888 / 34980 FlyBaseID:FBgn0028523 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_492348.1 Gene:egg-6 / 172670 WormBaseID:WBGene00010621 Length:961 Species:Caenorhabditis elegans

Alignment Length:506 Identity:109/507 (21%)
Similarity:182/507 (36%) Gaps:182/507 (36%)


  Fly    89 SLIVQNCAIPNAESIKYLLSKLGVSNYTELEIFN-------------------------YFDPKK 128
            |:|:.:|   |.|.:|.:...:|.|...||.|.|                         .|.|..
 Worm    37 SMIILSC---NGEDVKTIAQTVGTSQIDELHILNGTDVKIESLPFNGLRTIAILNSTLQSFSPTA 98

  Fly   129 TDRGEVLQQHYT-DHESLKKVSIIGFKSTL-------------PENFLENLPALQQLSLKGSS-- 177
            ....|...:|.| :...||.|.:.|..|||             |:.....|.||.||.|:.::  
 Worm    99 WRHVEATIEHITINGNELKTVPVFGNLSTLMSMNLNSNQISSIPDKAFNGLSALTQLRLENNAIC 163

  Fly   178 DLPGNILHPLK-NLTHLEIVVKNLGKVSGAIFAKQSKLKHLMIDCDAKNSSVEMSAFGPQELWHM 241
            |.|...|..:| :|..|::....|..:...|....:.|.:|  |..:.|.| |::.|   ||.::
 Worm   164 DFPPKSLDAVKASLVLLDVSGNCLDAIPAQILRNAANLMYL--DLGSNNIS-EINNF---ELMNL 222

  Fly   242 TELQSIELFN---------CGDNVPTELFWMSEQLAYIGIRSN-ISYLS---------------- 280
            ..|:.:.:.|         ...|||        ||.|:.::.| ||.|.                
 Worm   223 PFLRELRVQNNTLRRIHPMAFMNVP--------QLQYLYLQDNIISTLDGNRLQGFKNLEVLDVS 279

  Fly   281 ----------KDF-----LKVQKKLLT---------------LRLERNNIARLPDQLFRNTPLIL 315
                      ||.     ::|...|:|               :.::.|||.::....|.:...::
 Worm   280 NNALYALPSLKDLPNLKQVRVDGNLITKIETLAFSNNPNLQLISVQNNNIVQISRNSFESLDKLV 344

  Fly   316 EIHLAFNNLDRIQSGLFDKLKNLQVLNLEHNPITTIALNAFTPIPTAHI---------------- 364
            .:.:..|:|.:|:.|:||.:||||.|::.:|.:|.:..::|..:  ||:                
 Worm   345 VLLVGNNSLAKIERGMFDGMKNLQQLSIRNNTLTALDASSFAQL--AHLTTLDLGHNKIHDIEEG 407

  Fly   365 ---YVGKL------------FKAA----KNADWARSTNATICEEEYIYGVCIYCKRDEYLDH--- 407
               .:.||            ||.:    |.::.....|..||:|.:          :|:|.:   
 Worm   408 TFDKLSKLFWLDLSNNKISGFKTSVFKKKISNILLDGNQLICDESF----------NEFLTYLIA 462

  Fly   408 --------FADSENCNKPNPKA----KDVLAKKAYE-----NQLKAMPTHS 441
                    |.....|:.|...|    ||::.|||.|     ::|..:|..|
 Worm   463 NKVRTFLPFQQEIMCHGPEKYAGVRLKDLMMKKANETLSEGSRLLGVPQGS 513

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5888NP_001285981.1 leucine-rich repeat 168..189 CDD:275380 8/24 (33%)
leucine-rich repeat 190..213 CDD:275380 4/23 (17%)
leucine-rich repeat 214..243 CDD:275380 9/29 (31%)
leucine-rich repeat 244..266 CDD:275380 5/31 (16%)
leucine-rich repeat 267..289 CDD:275380 9/54 (17%)
LRR_8 288..348 CDD:290566 18/75 (24%)
leucine-rich repeat 290..313 CDD:275380 6/38 (16%)
leucine-rich repeat 314..337 CDD:275380 7/23 (30%)
leucine-rich repeat 338..357 CDD:275380 6/19 (32%)
egg-6NP_492348.1 LRR_8 107..162 CDD:290566 16/55 (29%)
leucine-rich repeat 107..127 CDD:275380 7/20 (35%)
leucine-rich repeat 128..151 CDD:275380 3/23 (13%)
LRR_RI <144..281 CDD:238064 35/151 (23%)
leucine-rich repeat 152..200 CDD:275380 12/48 (25%)
LRR_8 176..233 CDD:290566 15/63 (24%)
leucine-rich repeat 201..224 CDD:275380 9/29 (31%)
LRR_8 225..283 CDD:290566 12/66 (18%)
leucine-rich repeat 225..248 CDD:275380 5/31 (16%)
LRR_RI <240..458 CDD:238064 46/238 (19%)
leucine-rich repeat 249..272 CDD:275380 6/23 (26%)
LRR_8 271..329 CDD:290566 7/58 (12%)
leucine-rich repeat 273..294 CDD:275380 2/21 (10%)
leucine-rich repeat 295..318 CDD:275380 3/23 (13%)
LRR_8 317..375 CDD:290566 15/58 (26%)
leucine-rich repeat 319..342 CDD:275380 4/23 (17%)
leucine-rich repeat 343..366 CDD:275380 7/23 (30%)
LRR_8 365..425 CDD:290566 12/62 (19%)
leucine-rich repeat 367..390 CDD:275380 7/25 (28%)
leucine-rich repeat 391..414 CDD:275380 0/23 (0%)
leucine-rich repeat 415..434 CDD:275380 3/19 (16%)
leucine-rich repeat 437..449 CDD:275378 2/12 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.