DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5888 and lron-9

DIOPT Version :9

Sequence 1:NP_001285981.1 Gene:CG5888 / 34980 FlyBaseID:FBgn0028523 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001076615.1 Gene:lron-9 / 172529 WormBaseID:WBGene00011971 Length:653 Species:Caenorhabditis elegans


Alignment Length:432 Identity:100/432 - (23%)
Similarity:176/432 - (40%) Gaps:117/432 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VKEPNLCECQEQ-EIK------------CENLQLHSDNLQLYGISCSIFDARGFGYIPPLKVGNI 87
            :|...:.||..| |:|            ..||.:|:.|||.               |||    ::
 Worm   109 LKSLEIKECSGQDELKVGDDSFKGLEQTLRNLTIHACNLQT---------------IPP----SV 154

  Fly    88 GSLIVQNCAIPNAESIKY---LLSKLGVSNYTELEIFNY---------------FDPKKTDRGEV 134
            .||       .|.|::.:   .|..|||..:...:..:|               |:|..:....|
 Worm   155 DSL-------ENLETVVFSNNKLDSLGVDQFKNKKQLSYLDVSGNFITSIEEKAFEPLTSLETLV 212

  Fly   135 LQQHYTDHESLKKVSIIGFKSTL--------------PENFLENLPALQQLSLKGSSDLPGNILH 185
            :.:|...:|::  |..||....|              ||...:.:|.::.|.|.|.| :|  .|.
 Worm   213 IGEHNFINETV--VEEIGRLKALKTLDLSRADGIFQPPETLFKEIPQIEVLKLSGCS-IP--TLE 272

  Fly   186 P-----LKNLTHLEIVVKNLGKVSGAIFAKQSKLKHLMIDCDAKNSSVEMSAFGPQELWHMTELQ 245
            |     ||.|..|::.|..:..::...|.....|..|.:   |.|.   :|...|...:.::.|:
 Worm   273 PGQFATLKKLKELDLRVNLIENITAYAFDGLESLTRLSL---AGNF---ISKLEPDVFFGLSSLE 331

  Fly   246 SIEL-FNCGDNVPTELFW-MSEQLAYIGIRSN-ISYLSKDFLKVQKKLLTLRLERNNIARLPDQL 307
            .::| :|....:||::|. ::::|..|.:|:| ||.|....|.:.:||........:|:  .|||
 Worm   332 ELDLGWNEIKTIPTDVFKPLTDKLKTISLRNNPISELPSTGLGMLEKLSLAECGFTSIS--ADQL 394

  Fly   308 FRNTPLILEIHLAFNNLDRIQSGLFDKLK-NLQVLNLEHNPITTIALNAFTPIP-------TAHI 364
             ::.|.:.|:.|:..|:..|....|:..| :|:.|||:.|.:.::. |....:|       :::.
 Worm   395 -KDYPKLEELDLSKCNISNIVENTFENQKDSLKKLNLQKNKLKSLP-NLIKNLPAIESLDVSSNP 457

  Fly   365 Y------VGKLF-------KAAKNAD--WARSTNATICEEEY 391
            |      |..:|       ||.:|.:  :..:||.|:|:..|
 Worm   458 YRCDGELVNFVFGVEDRVKKAEENGNSFFVANTNETVCDRPY 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5888NP_001285981.1 leucine-rich repeat 168..189 CDD:275380 8/25 (32%)
leucine-rich repeat 190..213 CDD:275380 4/22 (18%)
leucine-rich repeat 214..243 CDD:275380 6/28 (21%)
leucine-rich repeat 244..266 CDD:275380 6/23 (26%)
leucine-rich repeat 267..289 CDD:275380 8/22 (36%)
LRR_8 288..348 CDD:290566 18/60 (30%)
leucine-rich repeat 290..313 CDD:275380 5/22 (23%)
leucine-rich repeat 314..337 CDD:275380 6/23 (26%)
leucine-rich repeat 338..357 CDD:275380 6/18 (33%)
lron-9NP_001076615.1 leucine-rich repeat 137..159 CDD:275380 11/47 (23%)
LRR_8 159..217 CDD:290566 10/57 (18%)
leucine-rich repeat 160..183 CDD:275380 5/22 (23%)
leucine-rich repeat 184..207 CDD:275380 3/22 (14%)
leucine-rich repeat 208..232 CDD:275380 6/25 (24%)
LRR_8 233..292 CDD:290566 16/61 (26%)
leucine-rich repeat 233..257 CDD:275380 3/23 (13%)
LRR_RI 234..456 CDD:238064 56/234 (24%)
leucine-rich repeat 258..281 CDD:275380 8/25 (32%)
LRR_8 280..340 CDD:290566 14/65 (22%)
leucine-rich repeat 282..305 CDD:275380 4/22 (18%)
leucine-rich repeat 306..329 CDD:275380 6/28 (21%)
LRR_8 328..410 CDD:290566 23/84 (27%)
leucine-rich repeat 330..375 CDD:275380 14/44 (32%)
leucine-rich repeat 376..399 CDD:275380 6/25 (24%)
LRR_8 398..457 CDD:290566 14/59 (24%)
leucine-rich repeat 400..420 CDD:275380 5/19 (26%)
leucine-rich repeat 425..447 CDD:275380 6/22 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.