DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5888 and lrrc38

DIOPT Version :8

Sequence 1:NP_001285981.1 Gene:CG5888 / 34980 FlyBaseID:FBgn0028523 Length:455 Species:Drosophila melanogaster
Sequence 2:XP_017951531.1 Gene:lrrc38 / 101731532 XenbaseID:XB-GENE-955337 Length:232 Species:Xenopus tropicalis

Alignment Length:165 Identity:39/166 (23%)
Similarity:71/166 (43%) Gaps:32/166 (19%)


  Fly   256 VPTELFWMSEQLAYIGIRSN-ISYLSKDFLKVQKKLLTLRLERNNIARLPDQLFRNTPLILEIHL 319
            :|.:|......|.|:.:::| ::.|.:.......:||.|.|..||:.:|....|::...:::::|
 Frog    70 IPADLLLFYGDLIYLDLKNNSLTSLEEGTFSSSSRLLFLDLSYNNLTQLDAGTFKSAEKLIKLYL 134

  Fly   320 AFNNLDRIQSGLFDKLKNLQVLNLEHNPITTI---ALNAFTPIPTAHIYVGKLFKAAKNADWARS 381
            ..|||..:....|:.|.:||||.|.:|.:.::   ||.|.|.:.|..:                .
 Frog   135 GNNNLSEVHEAAFESLSSLQVLELHNNNLQSLSVTALEALTSLRTIRL----------------D 183

  Fly   382 TNATICEEEYIYGVCIYCKRDEYLDHFADSENCNK 416
            .|..||:       |.:.....::|     ||..|
 Frog   184 GNPWICD-------CDFANLFFWID-----ENAQK 206

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5888NP_001285981.1 leucine-rich repeat 168..189 CDD:275380
leucine-rich repeat 190..213 CDD:275380
leucine-rich repeat 214..243 CDD:275380
leucine-rich repeat 244..266 CDD:275380 2/10 (20%)
leucine-rich repeat 267..289 CDD:275380 4/23 (17%)
LRR_8 288..348 CDD:290566 20/60 (33%)
leucine-rich repeat 290..313 CDD:275380 8/23 (35%)
leucine-rich repeat 314..337 CDD:275380 6/23 (26%)
leucine-rich repeat 338..357 CDD:275380 9/22 (41%)
lrrc38XP_017951531.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.