DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4278 and NIF3

Sequence 1:NP_609790.1 Gene:CG4278 FlyBaseID:FBgn0014092 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_011294.1 Gene:NIF3 SGDID:S000003189 Length:288 Species:Saccharomyces cerevisiae

Alignment Length:284 Identity:105/285 (37%)
Similarity:159/285 (56%) Gaps:26/285 (9%)


  Fly    12 KLAAVVKELENFAPTSWAEK-WDNVGLLIE------PHREKQIK-KILLTNDLTEPVVKEALEKE 68
            :|..:|:.:..|.|..:|:| |||.||||:      ...:...| |:|||.|||:.|.:||::..
Yeast     9 QLDKLVRSITKFYPQKYADKSWDNTGLLIDCSTAQVTTADANAKTKVLLTVDLTKSVAQEAVDAN 73

  Fly    69 AELIISYHPPIFKPLTRIT-QSHWKERVVAACLANDIALYSPHTAWDKKSGGVNDWLSKAV---- 128
            ..:|::|||.||....|:: .::.:.......:...|::|.||||.|...|||||||.:.:    
Yeast    74 CNVIVAYHPFIFPSWNRLSPHTNPQHETAIKLIQYGISVYCPHTAVDAARGGVNDWLVRGLNNGE 138

  Fly   129 NIISIRPLEPELGAPPG-TGSGRYIETKMELS--QVVESLQKRIRNSVHVALAVGHTP----KTL 186
            |:.....||...|.... .|.||::|...::|  |:|::: ||:....:|.:|....|    :..
Yeast   139 NVAKSYALETVSGETDDLIGYGRFVEFNKDISLEQIVKNV-KRVLRVPYVQVASLAAPSAWNQLK 202

  Fly   187 IQSVGICAGSGASLLKGIQ--ADLIITGEMSHHEVLEFTHNNTTVLLCNHSNSERGFLHEFCPIL 249
            |:.|.:|||||:.:.|.::  .||..||||||||||::.....||::|||||:|||||.:....|
Yeast   203 IKKVAVCAGSGSGVFKQLKEDVDLYYTGEMSHHEVLKWKEMGKTVIVCNHSNTERGFLQDVMKGL 267

  Fly   250 AKSLNEECLVFVSEVDKDPLVTVA 273
            .:....|  |.||::|.||| |||
Yeast   268 LQDEGHE--VVVSKMDCDPL-TVA 288

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4278NP_609790.1 NIF3 16..251 CDD:280036 93/257 (36%)
NIF3NP_011294.1 YbgI_SA1388 8..284 CDD:213534 100/278 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C258062391
eggNOG 1 0.900 E1_COG0327
Hieranoid 1 1.000
Homologene 1 1.000 H5881
Inparanoid 1 1.050 151 1.000 Inparanoid score I1108
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004533
OrthoInspector 1 1.000 T1136114
orthoMCL 1 0.900 OOG5_128139
Panther 1 1.100 LDO PTHR13799
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R811
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.