DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4278 and Nif3l1

Sequence 1:NP_609790.1 Gene:CG4278 FlyBaseID:FBgn0014092 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_075364.2 Gene:Nif3l1 MGIID:1929485 Length:376 Species:Mus musculus

Alignment Length:349 Identity:120/350 (34%)
Similarity:173/350 (49%) Gaps:90/350 (26%)


  Fly    13 LAAVVKELENFAPTSWAEKWDNVGLLIEPHREKQIKKILLTNDLTEPVVKEALEKEAELIISYHP 77
            |.|::..|.:||..|:||.|||||||:||.....:..:.|||||||.|:.|||:|:|:.|:||||
Mouse    29 LKALLSSLNDFASLSFAESWDNVGLLVEPSPPHTVNTLFLTNDLTEEVMDEALQKKADFILSYHP 93

  Fly    78 PIFKPLTRITQSHWKERVVAACLANDIALYSPHTAWDKKSGGVNDWLSKAVNIISIRPLEPELGA 142
            |||:|:..||...|||.:|...|.|.:|:||||||:|....|||.||:|.:...:.||:.|. .|
Mouse    94 PIFRPMKHITWKTWKECLVIRALENRVAVYSPHTAYDAAPQGVNSWLAKGLGTCTTRPIHPS-RA 157

  Fly   143 P--------------------------------------PG------------------------ 145
            |                                      |.                        
Mouse   158 PDYPTEGAHRLEFSVNRSQDLDKVMSTLRGVGGVSVTSFPARCDGEEQTRISLNCTQKTLMQVLA 222

  Fly   146 ------------------------TGSGRY--IETKMELSQVVESLQKRIRNS-VHVALAVGHTP 183
                                    ||.||.  ::..:.|:.::|.::..::.| :.:||.||.|.
Mouse   223 FLSQDRQLYQKTEILSLEKPLLLHTGMGRLCTLDESVSLAIMIERIKTHLKLSHLRLALGVGRTL 287

  Fly   184 KTLIQSVGICAGSGASLLKGIQADLIITGEMSHHEVLEFTHNNTTVLLCNHSNSERGFLHEFCPI 248
            ::.::.|.:|||||.|:|:|::|||.:|||||||:||:.......|:||.|||:|||||.|...:
Mouse   288 ESQVKVVALCAGSGGSVLQGVEADLYLTGEMSHHDVLDAASKGINVILCEHSNTERGFLSELQEM 352

  Fly   249 LAKSLNEECLVFVSEVDKDPLVTV 272
            |......:..:.:||.|:|||..|
Mouse   353 LGVHFENKINIILSETDRDPLRVV 376

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4278NP_609790.1 NIF3 16..251 CDD:280036 111/324 (34%)
Nif3l1NP_075364.2 NIF3 32..353 CDD:280036 110/322 (34%)
Mediates interaction with COPS2. {ECO:0000269|PubMed:12522100} 243..376 52/133 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C258052758
eggNOG 1 0.900 E1_COG0327
Hieranoid 1 1.000
Homologene 1 1.000 H5881
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004533
OrthoInspector 1 1.000 T1083594
orthoMCL 1 0.900 OOG5_128139
Panther 1 1.100 LDO PTHR13799
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R811
TreeFam 1 0.960
1211.740

Return to query results.
Submit another query.