DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4278 and nif3l1

Sequence 1:NP_609790.1 Gene:CG4278 FlyBaseID:FBgn0014092 Length:292 Species:Drosophila melanogaster
Sequence 2:XP_012825866.1 Gene:nif3l1 XenbaseID:XB-GENE-1016729 Length:372 Species:Xenopus tropicalis

Alignment Length:347 Identity:125/348 (36%)
Similarity:173/348 (50%) Gaps:89/348 (26%)


  Fly    13 LAAVVKELENFAPTSWAEKWDNVGLLIEPHREKQIKKILLTNDLTEPVVKEALEKEAELIISYHP 77
            |.:||..|....|.:.||.|||||||:||....|:.|:||||||||.|:.||::..|.:|:||||
 Frog    28 LGSVVSRLNVLTPPALAEGWDNVGLLVEPSPPHQVHKLLLTNDLTEDVLDEAIDTGANMILSYHP 92

  Fly    78 PIFKPLTRITQSHWKERVVAACLANDIALYSPHTAWDKKSGGVNDWLSKA--------------- 127
            |:||.|.||||..||||:|...|...:|:|||||:.|..:.||||||::|               
 Frog    93 PVFKALKRITQKSWKERLVVKALEKHLAVYSPHTSCDALANGVNDWLARALGPSKSVPLRASTSL 157

  Fly   128 --------------------------------------------------------VNIISIRPL 136
                                                                    |.::||...
 Frog   158 TYPGGVGHLLEFRLDPAGNIMSRLNGIQGVSVCTSTARHDGDNGTRVSLSCSQNALVEVLSILSE 222

  Fly   137 EPE---------LGAPP--GTGSGRYIETKMELSQVVESLQKRIRNSVH-----VALAVGHTPKT 185
            ||:         |..||  .||.|| :.|..|...:..:|: ||:..:|     :||..|.|.::
 Frog   223 EPQVYNSLQLLTLQKPPLVDTGMGR-LCTLSEPVSIAAALE-RIKKHLHLPHLRLALGRGRTLES 285

  Fly   186 LIQSVGICAGSGASLLKGIQADLIITGEMSHHEVLEFTHNNTTVLLCNHSNSERGFLHEFCPILA 250
            .:....:|||||:|:|.|:.|:|.:|||||||:||:......:|:||.|||||||:|.|....:.
 Frog   286 SVSMAAVCAGSGSSILSGVPAELYLTGEMSHHDVLDAVAEGRSVVLCEHSNSERGYLQELGGQIR 350

  Fly   251 KSLNEECLVFVSEVDKDPLVTV 272
            ::|..:..|.||:.|:|||..|
 Frog   351 QALEGQVQVVVSQRDRDPLQVV 372

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4278NP_609790.1 NIF3 16..251 CDD:280036 115/322 (36%)
nif3l1XP_012825866.1 NIF3 31..352 CDD:280036 115/323 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C258051799
eggNOG 1 0.900 E1_COG0327
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H5881
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1293706at2759
OrthoFinder 1 1.000 FOG0004533
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.