DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cact and nfkbib

Sequence 1:NP_001260496.1 Gene:cact FlyBaseID:FBgn0000250 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_001122267.1 Gene:nfkbib ZFINID:ZDB-GENE-070705-529 Length:394 Species:Danio rerio

Alignment Length:419 Identity:103/420 (25%)
Similarity:166/420 (40%) Gaps:101/420 (24%)


  Fly   123 EDQEEQEKEEEHQDTTTATADSMRLKHSADTGIPQW---------------TVESHLVSRGEQL- 171
            |..::...|...|:.....:|::..:.:.|:....|               .|.....:..||: 
Zfish     2 EGTQDIHGESRRQNARPGRSDAVEKRGALDSVSEDWCDSGLDSFSGVGLSFDVPYDTYTETEQMW 66

  Fly   172 ------------------NNLGQSSSTQITGRSKVQSSTASTANAN------PSGSGATSSAPPS 212
                              :|...:....|.|..::.|:...:.|.:      .:|.|....:.|:
Zfish    67 TPGRCVSDIRDIPPSDAPDNRSSADCVSIGGGERLDSAIGDSINEDAVVGCLSAGIGTMILSEPA 131

  Fly   213 SIN---IMNAWEQFYQQ----------NDDGDTPLHLACISGSVDVVAALIR-------MAPHPC 257
            ..:   :.|..|...::          ::||||.||||.|.....||..|::       ..|:  
Zfish   132 GTDRQAVTNTEEGRQRREELFNTLNFLSEDGDTVLHLALIHEQWGVVQCLLQNIGMDNTWIPY-- 194

  Fly   258 LLNIQNDVAQTPLHLAALTAQPNIMRILLLAGAEPTVRDRHGNTALHLSCIAGEKQCVRALTEKF 322
             |:||||:.||.||||.:......:|.||.:||...:::|.|||.|||:......:|||.||   
Zfish   195 -LDIQNDLGQTALHLAVIVDSSECVRALLWSGASAEIQERGGNTPLHLAVRELRTECVRELT--- 255

  Fly   323 GATEIHEAHRQYGHRSNDKAVSSLSYACL---PADLEIRNYDGERCVHLAAEAGHIDILRILVSH 384
                                      :|.   |..|.:.||.|...:|||...|:.|::::|:..
Zfish   256 --------------------------SCSRTPPEHLNLTNYAGVSALHLAVYRGNFDVIKMLLEA 294

  Fly   385 GADINAREGKSGRTPLHIAIEGCNEDLANFLLDECEKLNLETATYAGLTAYQFACIMNKSRMQNI 449
            |||.|.|:..|||:|||.|:|....:....||.....:|  ..:|||.|.:..|.......:|.:
Zfish   295 GADANQRDLGSGRSPLHWAVESQKLETVELLLSAGALVN--QRSYAGHTPFYCALYRPNKDIQTL 357

  Fly   450 LEKRGAETVTPPDSDYD---SSDIEDLDD 475
            |...|| |.:..|.:.:   .|:.|:.||
Zfish   358 LRAHGA-TYSQDDEEEEECRESEEEEFDD 385

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cactNP_001260496.1 ANK <225..286 CDD:238125 26/78 (33%)
ANK repeat 229..263 CDD:293786 16/41 (39%)
Ank_4 230..286 CDD:290365 25/63 (40%)
ANK 260..416 CDD:238125 53/159 (33%)
ANK repeat 265..296 CDD:293786 11/31 (35%)
Ank_2 270..391 CDD:289560 37/124 (30%)
ANK repeat 298..324 CDD:293786 11/26 (42%)
ANK repeat 361..393 CDD:293786 12/32 (38%)
Ank_5 381..438 CDD:290568 21/57 (37%)
ANK repeat 395..425 CDD:293786 11/30 (37%)
nfkbibNP_001122267.1 Ank_2 <155..231 CDD:289560 29/79 (37%)
ANK <155..222 CDD:238125 26/70 (37%)
ANK repeat 161..199 CDD:293786 16/41 (39%)
ANK 196..326 CDD:238125 53/159 (33%)
ANK repeat 202..232 CDD:293786 11/30 (37%)
Ank_2 206..302 CDD:289560 38/125 (30%)
ANK repeat 235..269 CDD:293786 14/63 (22%)
ANK repeat 271..302 CDD:293786 12/31 (39%)
Ank_5 291..346 CDD:290568 21/57 (37%)
ANK repeat 305..333 CDD:293786 10/28 (36%)
ANK repeat 338..363 CDD:293786 7/25 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T596563
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.