DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cact and NFKBIE

Sequence 1:NP_001260496.1 Gene:cact FlyBaseID:FBgn0000250 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_004547.2 Gene:NFKBIE HGNCID:7799 Length:500 Species:Homo sapiens

Alignment Length:500 Identity:129/500 (26%)
Similarity:193/500 (39%) Gaps:144/500 (29%)


  Fly     2 PSPTKAAEAATKATATSDCSCSAASVEQRAPSNAANPSSSLATSGKIGGKTQDQTAAINKQKEFA 66
            |.|.|||..:.:....           |..|..|.....|.|..|                    
Human   113 PQPGKAARRSLEPDPA-----------QTGPRPARAAGMSEARKG-------------------- 146

  Fly    67 VPNETSDSGFISGPQSSQIFSEEIVPDSEEQDKDQQESAPQ------KEQPVVLDSGIIDEEEDQ 125
             |:|..:|.:.||.:|  :.|...:|:|        .|||.      ..||.....|.:  :|.|
Human   147 -PDEAEESQYDSGIES--LRSLRSLPES--------TSAPASGPSDGSPQPCTHPPGPV--KEPQ 198

  Fly   126 EEQEKEEEHQDTTTATADSMRLKHSADTGIPQWTVESHLVSRGEQLNNLGQSSSTQITGRSKVQS 190
            |:::.:.|..|:|                                   .|.||.|.         
Human   199 EKEDADGERADST-----------------------------------YGSSSLTY--------- 219

  Fly   191 STASTANANPSGSGATSSAPPSSINIMNA-----WEQFYQQNDDGDTPLHLACISGSVDVVAALI 250
             |.|..    .|..|...||...:..:.|     .|.....::||||.:|||.|..:..|:...:
Human   220 -TLSLL----GGPEAEDPAPRLPLPHVGALSPQQLEALTYISEDGDTLVHLAVIHEAPAVLLCCL 279

  Fly   251 RMAPHPCLLNIQNDVAQTPLHLAALTAQPNIMRILLLAGAEPTVRDRHGNTALHLSCIAGEKQCV 315
            .:.|.. :|:|||::.||.||||....||..:|.|:|.||...::||||:||||::|......|.
Human   280 ALLPQE-VLDIQNNLYQTALHLAVHLDQPGAVRALVLKGASRALQDRHGDTALHVACQRQHLACA 343

  Fly   316 RALTEKFGATEIHEAHRQYGHRSNDKAVS-SLSYACLPADLEIRNYDGERCVHLAAEAGHIDILR 379
            |.|.|              |.....:..| ||       ||:::|:.|..|:|:|....:..::.
Human   344 RCLLE--------------GRPEPGRGTSHSL-------DLQLQNWQGLACLHIATLQKNQPLME 387

  Fly   380 ILVSHGADINAREGKSGRTPLHIAIEGCNEDLANFL-----------LDECEKLNLETATYAGLT 433
            :|:.:||||:.:||.||:|.||:|:|.....|..||           |:.|..|:|.    ||..
Human   388 LLLRNGADIDVQEGTSGKTALHLAVETQERGLVQFLLQAGAQVDARMLNGCTPLHLA----AGRG 448

  Fly   434 AYQFACIMNKSRMQNILEKRGAETVTPPDSDYDSSDIEDLDDTKM 478
            ....:..:.|:...::|  |..|..||.|...:|..:...||.|:
Human   449 LMGISSTLCKAGADSLL--RNVEDETPQDLTEESLVLLPFDDLKI 491

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cactNP_001260496.1 ANK <225..286 CDD:238125 24/61 (39%)
ANK repeat 229..263 CDD:293786 13/34 (38%)
Ank_4 230..286 CDD:290365 23/56 (41%)
ANK 260..416 CDD:238125 57/168 (34%)
ANK repeat 265..296 CDD:293786 13/31 (42%)
Ank_2 270..391 CDD:289560 40/122 (33%)
ANK repeat 298..324 CDD:293786 11/26 (42%)
ANK repeat 361..393 CDD:293786 10/32 (31%)
Ank_5 381..438 CDD:290568 23/68 (34%)
ANK repeat 395..425 CDD:293786 14/41 (34%)
NFKBIENP_004547.2 ANK 1 258..291 13/34 (38%)
ANK repeat 293..324 CDD:293786 13/31 (42%)
ANK 2 293..322 13/29 (45%)
Ank_2 298..399 CDD:289560 40/122 (33%)
ANK 323..456 CDD:238125 47/158 (30%)
ANK repeat 326..367 CDD:293786 17/62 (27%)
ANK 3 326..355 12/43 (28%)
ANK 4 369..398 9/29 (31%)
ANK repeat 370..400 CDD:293786 9/30 (30%)
Ank_2 374..467 CDD:289560 28/99 (28%)
ANK repeat 403..434 CDD:293786 10/31 (32%)
ANK 5 403..432 10/29 (34%)
ANK repeat 436..467 CDD:293786 8/37 (22%)
ANK 6 436..465 6/33 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000770
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.