DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cact and nfki-1

Sequence 1:NP_001260496.1 Gene:cact FlyBaseID:FBgn0000250 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_510540.1 Gene:nfki-1 WormBaseID:WBGene00007877 Length:611 Species:Caenorhabditis elegans

Alignment Length:446 Identity:100/447 (22%)
Similarity:168/447 (38%) Gaps:103/447 (23%)


  Fly    33 SNAANPSSSLATSGKIGGKTQDQTAAINKQKEFAVPNETSDSGF--ISGPQSSQIFSEEIVPDSE 95
            |.:..|.:.|::.| .|..:..|.:          |.|:..|.|  ||...:|::    :.|::.
 Worm   213 SASTTPDTVLSSDG-YGSASPPQHS----------PKESLQSPFSDISSADTSRV----LTPENN 262

  Fly    96 EQDKDQQESAPQKEQPVVLDSGIIDEEEDQEEQEKEEE------HQDTTTATADSMRLKHSADTG 154
            |        .|:..|..:|        :...:..|||.      ..|:..::..|.|....|...
 Worm   263 E--------LPESLQDFIL--------QYSNQYTKEESIRGRPPSADSGVSSPMSARSAPYASPH 311

  Fly   155 IPQWTVESHLVSRGEQLNNLGQSSSTQITGRSKVQSSTASTANANPSGSGATSSAPPSSINIMNA 219
            :||.|..........|.....::|...||.:.::.:....:..|.......|:            
 Worm   312 VPQGTCSGPTTPSFNQTRLSPRTSENGITAKQRLNAIIPESDLATGFHWACTT------------ 364

  Fly   220 WEQFYQQND-DGDTPLHLACISGSVDVVAALIRMAPHPC-------------LLNIQNDVAQTPL 270
            |:......| |||||||:......:..:.||       |             :.|:.|:..:|||
 Worm   365 WKNVLTNRDADGDTPLHIVAAHNDLGKIYAL-------CETLRKTMNENDDNVFNVSNNFGETPL 422

  Fly   271 HLAALTAQPNIMRILLLAGAEPTVRDRH--GNTALHLSCIAGEKQCVRALTEKFGATEIHEAHRQ 333
            ::|.|.....::..||..||.|..|...  |::.||.:...|....|.||..|   .||..    
 Worm   423 YVAVLQRSIEVVEYLLELGASPNSRSSRAVGDSPLHFATARGMNNMVEALLSK---REIRV---- 480

  Fly   334 YGHRSNDKAVSSLSYACLPADLEIRNYDGERCVHLAAEAGHIDILRILVSHGADINAREGKSGRT 398
              :.:||...:||..|     :::.....|:..|   :..:..|:.:|:..|||....|..:|:|
 Worm   481 --NETNDDGQTSLLCA-----VKMHGMMDEQTQH---KIDNKSIIEMLIKAGADPTIAETSTGKT 535

  Fly   399 PLHIAIEGCNEDLANFL---LDE---CEKLNLETATYAGLTAYQFACIMNKSRMQN 448
            .:|.|::..:.:|.:||   ::|   .|..||  :.:.|.||....|    |..||
 Worm   536 IVHHAVDKMDVELLDFLKTVVNEDTFTELANL--SDFHGDTAVDLLC----SSTQN 585

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cactNP_001260496.1 ANK <225..286 CDD:238125 19/75 (25%)
ANK repeat 229..263 CDD:293786 11/47 (23%)
Ank_4 230..286 CDD:290365 17/69 (25%)
ANK 260..416 CDD:238125 43/161 (27%)
ANK repeat 265..296 CDD:293786 11/31 (35%)
Ank_2 270..391 CDD:289560 31/123 (25%)
ANK repeat 298..324 CDD:293786 8/28 (29%)
ANK repeat 361..393 CDD:293786 8/32 (25%)
Ank_5 381..438 CDD:290568 19/63 (30%)
ANK repeat 395..425 CDD:293786 11/36 (31%)
nfki-1NP_510540.1 Ank_2 <372..447 CDD:315466 23/82 (28%)
ANK repeat 375..415 CDD:293786 11/47 (23%)
ANK 412..552 CDD:238125 42/157 (27%)
ANK repeat 417..448 CDD:293786 11/31 (35%)
ANK repeat 486..527 CDD:293786 10/49 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I3898
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000770
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.