DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cact and ikb-1

Sequence 1:NP_001260496.1 Gene:cact FlyBaseID:FBgn0000250 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_492575.1 Gene:ikb-1 WormBaseID:WBGene00002069 Length:597 Species:Caenorhabditis elegans

Alignment Length:460 Identity:105/461 (23%)
Similarity:181/461 (39%) Gaps:103/461 (22%)


  Fly    30 RAPSNAANPSSSLATSGKIGGKTQDQTAAINKQKEFAVPNETSDSGFISGPQSSQIFSEEIVPDS 94
            :|..|.||.:.:.....:...:....|::|:|                |..|..::|.::|    
 Worm     3 KADENDANLTENGVHKSRSDSEINSHTSSIHK----------------SSSQHRRLFIDDI---- 47

  Fly    95 EEQDKDQQESAPQKEQPVVLDSGIIDEEE--------DQEEQEKEEEHQDTTTATADSMRLKHSA 151
                  ....|...::.....||..|..|        ||.|:           :..|.:| ||| 
 Worm    48 ------STIEASAGDRVWATCSGAGDATELITIHFLGDQFEE-----------SAIDVVR-KHS- 93

  Fly   152 DTGIPQWTVESHLVSRGEQLNNLGQSSSTQITGRS------KVQ-SSTASTANANPSGSGATSSA 209
               :..:||.|..|....::.....:|:..:|..|      |:| |.|...:..:.....||:. 
 Worm    94 ---LVMFTVPSLKVDSELEVELRFSTSNDNVTTISFKYLPRKIQRSHTQEISLFDNLLEFATNG- 154

  Fly   210 PPSSINIMNAW-EQFYQQNDDGDTPLHLACISGSVDVVAALIRMAPHPC---LLNIQNDVAQTPL 270
              .:|:::..: .|..:|:.:|:|..|:|..:|....:..|:.:.|...   ::|:||....|.|
 Worm   155 --DTISLLQPFVAQISKQDIEGNTVFHVAAKNGQSFSLKLLLSVIPPDIKNEVINVQNTHGLTAL 217

  Fly   271 HLAALTAQPNIMRILLLAGAEPTVRDRHGNTALH--------------LSCIAGEKQCVRALTEK 321
            |:|..|..|:.:..|:..||:..:.|.||:||||              |....|::..|..|..:
 Worm   218 HVAIRTGDPDAVHYLMNHGAKIDISDNHGSTALHYLGDAYNESIFKEILEPSRGQRFDVNQLNSE 282

  Fly   322 FGATEIHEAHRQYGHRSNDKAVSSLSYACLPADLEIRNYDGER----CVHLAAEAGHIDILRILV 382
             |...||.|.|        :...||....:.|...|...|.|:    .:| |.|....:.:::||
 Worm   283 -GFAPIHVAVR--------RLKLSLIEMLIEAGALIDFLDTEKKRNALMH-AIEMNDFETIQLLV 337

  Fly   383 SHGADINAREGKSGRTPLHIAIEGCNEDLANFLLDECEKLNLETATYAGLTAYQFACIMNK--SR 445
            ..|:..|. |.:||.|.|.:|::..|..:...|||.....|.:.:  .|:      |:.:.  |.
 Worm   338 ERGSGTNI-EDESGETALSLAVKNVNYPVIGLLLDNGADPNRQNS--KGI------CLADSEDSV 393

  Fly   446 MQNIL 450
            :|||:
 Worm   394 IQNII 398

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cactNP_001260496.1 ANK <225..286 CDD:238125 18/64 (28%)
ANK repeat 229..263 CDD:293786 9/37 (24%)
Ank_4 230..286 CDD:290365 17/59 (29%)
ANK 260..416 CDD:238125 49/174 (28%)
ANK repeat 265..296 CDD:293786 9/31 (29%)
Ank_2 270..391 CDD:289560 37/139 (27%)
ANK repeat 298..324 CDD:293786 11/40 (28%)
ANK repeat 361..393 CDD:293786 10/36 (28%)
Ank_5 381..438 CDD:290568 16/57 (28%)
ANK repeat 395..425 CDD:293786 10/30 (33%)
ikb-1NP_492575.1 ANK 155..252 CDD:238125 29/97 (30%)
ANK repeat 173..210 CDD:293786 9/37 (24%)
Ank_2 178..280 CDD:289560 28/102 (27%)
ANK 207..337 CDD:238125 38/140 (27%)
ANK repeat 212..243 CDD:293786 9/31 (29%)
ANK repeat 282..313 CDD:293786 9/40 (23%)
Ank_2 287..380 CDD:289560 28/103 (27%)
ANK repeat 315..347 CDD:293786 9/34 (26%)
ANK repeat 349..380 CDD:293786 10/31 (32%)
Ank 350..380 CDD:278452 9/30 (30%)
Death_NFkB-like 515..592 CDD:260024
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000770
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
21.960

Return to query results.
Submit another query.