DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5861 and AT1G47640

Sequence 1:NP_609789.1 Gene:CG5861 FlyBaseID:FBgn0015338 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_564509.1 Gene:AT1G47640 AraportID:AT1G47640 Length:228 Species:Arabidopsis thaliana

Alignment Length:179 Identity:70/180 (39%)
Similarity:102/180 (57%) Gaps:14/180 (8%)


  Fly     1 MTLYHFGNCVALLT--PYYFTYKYSGLSEYGAFWKCVQAGGIYIFTQLVKMLVLATFFYSDAPSS 63
            |||:||.|| |:||  |:...|..:.||||......|:|..:|:.|.|||::.||||.   ..|.
plant     1 MTLFHFFNC-AILTFGPHAVYYSATPLSEYDTLGTSVKAAVVYLATALVKLVCLATFL---QVSE 61

  Fly    64 SGEFNFFAEILRCSMDIADLLGFALILSRIPGKGHS---KLITAGLGWATAEVILSRGIMLWVGA 125
            :..|:.:.|.|:..:...|:.|....|:::..:..|   |....|||||.|:.:|.|...|||||
plant    62 TEVFDPYQEALKAMIGFIDVAGLYYALAQLTHRNISQNHKFQAVGLGWAFADSVLHRLAPLWVGA 126

  Fly   126 RGTEFSWIYILKCLESNVLLVQHITTA---TLIWLFTRHDLNKALKPLV 171
            ||.||:|.|:|:.||:|..||..|:.|   :|:||  |.:..|:|.|::
plant   127 RGLEFTWDYVLQGLEANANLVFTISLAALGSLMWL--RKNKPKSLIPII 173

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5861NP_609789.1 DUF2053 2..160 CDD:286808 65/166 (39%)
AT1G47640NP_564509.1 DUF2053 2..161 CDD:286808 64/163 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H12330
Inparanoid 1 1.050 104 1.000 Inparanoid score I2083
OMA 1 1.010
OrthoDB 1 1.010 D1388283at2759
OrthoInspector 1 1.000 T192698
orthoMCL 1 0.900 OOG5_131748
Panther 1 1.100 LDO PTHR12869
Phylome 1 0.910 0.667 Consistency score
98.980

Return to query results.
Submit another query.