DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5861 and Tmem147

Sequence 1:NP_609789.1 Gene:CG5861 FlyBaseID:FBgn0015338 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_081491.2 Gene:Tmem147 MGIID:1915011 Length:224 Species:Mus musculus

Alignment Length:220 Identity:108/221 (49%)
Similarity:149/221 (67%) Gaps:6/221 (3%)


  Fly     1 MTLYHFGNCVAL-LTPYYFTYKYSGLSEYGAFWKCVQAGGIYIFTQLVKMLVLATFFYSDAPS-S 63
            |||:|||||.|| ..||:.|||.||||||.|||||||||..|:|.||.|||.|||||    |: .
Mouse     1 MTLFHFGNCFALAYFPYFITYKCSGLSEYNAFWKCVQAGVTYLFVQLCKMLFLATFF----PTWE 61

  Fly    64 SGEFNFFAEILRCSMDIADLLGFALILSRIPGKGHSKLITAGLGWATAEVILSRGIMLWVGARGT 128
            .|.::|..|.::.|:|:|||:|..|::||..|||..|::.|.|||||||:|:||.|.|||||||.
Mouse    62 GGIYDFIGEFMKASVDVADLIGLNLVMSRNAGKGEYKIMVAALGWATAELIMSRCIPLWVGARGI 126

  Fly   129 EFSWIYILKCLESNVLLVQHITTATLIWLFTRHDLNKALKPLVSLLLAVTVFKGVWLEGMLHILT 193
            ||.|.||...::||:.||.:|..:..:|:.||:||....:|.|.||:.::|:|...:|..:|:.:
Mouse   127 EFDWKYIQMSIDSNISLVHYIVASAQVWMITRYDLYHTFRPAVLLLMFLSVYKAFVMETFVHLFS 191

  Fly   194 IGPWLTVAVKALVAAVIGFCTLHIY 218
            :|.|..:..:|:|..::...||.:|
Mouse   192 LGSWTALLARAVVTGLLALSTLALY 216

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5861NP_609789.1 DUF2053 2..160 CDD:286808 89/160 (56%)
Tmem147NP_081491.2 DUF2053 2..158 CDD:286808 89/160 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C195540123
eggNOG 1 0.900 E1_KOG3236
Hieranoid 1 1.000
Homologene 1 1.000 H12330
Inparanoid 1 1.050 223 1.000 Inparanoid score I3496
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006285
OrthoInspector 1 1.000 T1083640
orthoMCL 1 0.900 OOG5_131748
Panther 1 1.100 LDO PTHR12869
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3948
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.